(data stored in SCRATCH zone)

EMBL: CU928166.PE373

CU928166.PE373       Location/Qualifiers
FT   CDS             complement(729231..731486)
FT                   /locus_tag="KLTH0B08976g"
FT                   /old_locus_tag="KLTH-ORF14681"
FT                   /product="KLTH0B08976p"
FT                   /note="highly similar to uniprot|P00958 Saccharomyces
FT                   cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
FT                   complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
FT                   which increases the catalytic efficiency of both tRNA
FT                   synthetases also has a role in nuclear export of tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21738"
FT                   /db_xref="GOA:C5DD77"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD77"
FT                   /protein_id="CAR21738.1"
FT                   /translation="MAFNLSFDRSKDHSYALQLANNIKLALAQELAGKEIKISVNDESV
FT                   KPELTVASTDFRLFNTNAILRYVLNDFEGLESSETHFAVSSLEAMLYHPSAPQEHVKEN
FT                   VSKALENYLQELREPFCATNLITFANAYALSPESLESKFANLPASLSKALSAAKSYTPR
FT                   LSSSFKRTGAVKINSNFAVKKQDAEILPIEGERNILITSALPYVNNVPHLGNIVGSVLS
FT                   ADIYARYCKARNYNTLFVCGTDEYGTATETKAIEEGCTPRELCDKYHKIHSDVYKWFQI
FT                   GFDYFGRTTTEKQTEIAQDIFNKLNNNGYLEEHSMKQLYCEEHKAYLADRYVEGECPKC
FT                   HYEDARGDQCDKCGGLLDPFELINPRCKLDNSKPIPRNSDHIFISLDKLEPRIKEWVEK
FT                   SSREGGWSKNSRTITQSWLKEGLQPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYV
FT                   SITANYTDGWKKWWKDPENVQLYQFMGKDNVPFHSVIFPGSQLGTNENWTMLHHLSTTE
FT                   YLQYEGGKFSKSRGVGVFGNNAKDTGVSPSVWRYYLASVRPESSDSHFSWSDFVARNNS
FT                   ELLANLGNFVNRLVKFVNAKYNGVVPEYDQKQLADFVKLEKDINSILSSYVSEMEQSHE
FT                   RRGLEIAMSLSARGNLFLQENKLDNSLFSEFPAKSDAVVGVGLNIVYSVASVIYPFMPE
FT                   AAETIYKMLNAPAKKIDDKFYLCIEGGHNINKAEYLFKRIDEKEIENWRSKYGGQQK"
     MAFNLSFDRS KDHSYALQLA NNIKLALAQE LAGKEIKISV NDESVKPELT VASTDFRLFN        60
     TNAILRYVLN DFEGLESSET HFAVSSLEAM LYHPSAPQEH VKENVSKALE NYLQELREPF       120
     CATNLITFAN AYALSPESLE SKFANLPASL SKALSAAKSY TPRLSSSFKR TGAVKINSNF       180
     AVKKQDAEIL PIEGERNILI TSALPYVNNV PHLGNIVGSV LSADIYARYC KARNYNTLFV       240
     CGTDEYGTAT ETKAIEEGCT PRELCDKYHK IHSDVYKWFQ IGFDYFGRTT TEKQTEIAQD       300
     IFNKLNNNGY LEEHSMKQLY CEEHKAYLAD RYVEGECPKC HYEDARGDQC DKCGGLLDPF       360
     ELINPRCKLD NSKPIPRNSD HIFISLDKLE PRIKEWVEKS SREGGWSKNS RTITQSWLKE       420
     GLQPRCITRD LVWGTPVPLE KYKDKVLYVW FDATIGYVSI TANYTDGWKK WWKDPENVQL       480
     YQFMGKDNVP FHSVIFPGSQ LGTNENWTML HHLSTTEYLQ YEGGKFSKSR GVGVFGNNAK       540
     DTGVSPSVWR YYLASVRPES SDSHFSWSDF VARNNSELLA NLGNFVNRLV KFVNAKYNGV       600
     VPEYDQKQLA DFVKLEKDIN SILSSYVSEM EQSHERRGLE IAMSLSARGN LFLQENKLDN       660
     SLFSEFPAKS DAVVGVGLNI VYSVASVIYP FMPEAAETIY KMLNAPAKKI DDKFYLCIEG       720
     GHNINKAEYL FKRIDEKEIE NWRSKYGGQQ K                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page