(data stored in SCRATCH zone)

EMBL: CU928166.PE379

CU928166.PE379       Location/Qualifiers
FT   CDS             join(741971..741992,742080..742474)
FT                   /locus_tag="KLTH0B09108g"
FT                   /old_locus_tag="Klth0B.mRNA.688.p"
FT                   /product="KLTH0B09108p"
FT                   /note="similar to uniprot|Q03554 YMR292w Saccharomyces
FT                   cerevisiae GOT1 evolutionarily conserved non-essential
FT                   protein present in early Golgi cisternae that may be
FT                   involved in ER-Golgi transport at a step after vesicle
FT                   tethering to Golgi membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21744"
FT                   /db_xref="GOA:C5DD83"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD83"
FT                   /protein_id="CAR21744.1"
FT                   /translation="MWLTESQKFGVAFTFGGCLFFLFGVLTFFDRALLALGNILFLVGV
FT                   LLIIGPQKTYTFFTRPSKRRGSFFFCLGILMILLKWTFMGFIVESLGIVGLFGDFFAVI
FT                   VQFLRSLPLIGPVLSHPAVAPYVDKIAGVRVLPV"
     MWLTESQKFG VAFTFGGCLF FLFGVLTFFD RALLALGNIL FLVGVLLIIG PQKTYTFFTR        60
     PSKRRGSFFF CLGILMILLK WTFMGFIVES LGIVGLFGDF FAVIVQFLRS LPLIGPVLSH       120
     PAVAPYVDKI AGVRVLPV                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page