(data stored in SCRATCH zone)

EMBL: CU928166.PE380

CU928166.PE380       Location/Qualifiers
FT   CDS             742805..746806
FT                   /locus_tag="KLTH0B09130g"
FT                   /old_locus_tag="KLTH-ORF14657"
FT                   /product="KLTH0B09130p"
FT                   /note="similar to uniprot|P40340 Saccharomyces cerevisiae
FT                   YGR270W YTA7 Protein of unknown function member of
FT                   CDC48/PAS1/SEC18 family of ATPases potentially
FT                   phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21745"
FT                   /db_xref="GOA:C5DD84"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD84"
FT                   /protein_id="CAR21745.1"
FT                   /translation="MTRPLRPRHHEPLKNELDESSRGIKDENGIIHTTTRSLRKVNYAD
FT                   VENNYDFIDEVVDEDDEDEAAAPAGSRRRGHAIKSDSEEFEPAEKTEDEPEPPIEDHTA
FT                   QEVSGPETRNSKSRGGPDEDGDESFHEEDAEDEDEDALAGSEDEYLSEESIRRSRRRAD
FT                   RNFVVSDEDDEDEDTIGASKRTRRGYRTTTTIDTDEDDPPSRRNFRSSTIQARQGRRSE
FT                   ISPPRKLRRRARSAYGSEERQSRSDRLSLADELRELRDDSPVREKRSLRERTKPVNYTL
FT                   PPPIGDTAMDETAKLGNANGILPYPSPKARRGLHAGQSFGPLRRLFPTGGPFGGNDVTA
FT                   IFGTNTNYYDNAGQGTANNKLLLDSDSSEDEILPLGAVSTKPNESTHKKKKPEIADLDP
FT                   LGVDMNIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTL
FT                   MARALAASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEID
FT                   GLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDRE
FT                   FFFPLPDLSARSKILEIHTKKWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALISIQ
FT                   RKVPQIYQSEMKLSINLASVNVKARDFMMALEKIVPSSARSAGNSAQPIPETVEALLDS
FT                   QFEEIKKKLKSIIPSDSKFQRNGASTIKHYLEYEVEDSDEESDGFSKAEFLRNMEKARV
FT                   CKPRLIVTGSRGNGQQYVGAAILHYLEDFNMQMLDVGTLASDSTRSFETAIVQIFTEAR
FT                   RRQPSVLYIPNSEIWLQAVPENAILMLASLLRSLRSDEKVLLLAVANGLSKSDILEGSL
FT                   SHLEFEKFIHKIRKPSSSQRAKYFLSLKQILKTKPSSFEQGKKRTKPLPQLPVVESSKK
FT                   SEGLDKNGNPLSEEAKLIQTLKSFQNHDMKLKNTLKLKLSGLMDLFKNRYKRFRKPPID
FT                   DALLIHLFETNAALQGNPDYQPAYIKENNMILECATGRRFFNMDLDIVEERLWNGFYSE
FT                   PRQFLKDIELIYKDAHTSGDRERIIKASEMFVNAQMGIEEISAPDFVMECRDSRQRELT
FT                   RQKLNLEKQAKLKSQELSEELQVRANEVDISENDLSSSSEKFERNSLNGSHALQVGVGS
FT                   GGQLQCQAQKNPQEELQVEDATNDEQGNNTERQLPNDDINPLQIGNNEYKKDDAEAAEI
FT                   EGAIDGKHAESETPRNSSPENSKSSEQSSLSEEALIEEGGPQVAEFILDDNKLNDLLSL
FT                   LEHRSEGFTVQKLEELYAFALNIIWEDRLLWDRTTTLHKLLTHIENWGN"
     MTRPLRPRHH EPLKNELDES SRGIKDENGI IHTTTRSLRK VNYADVENNY DFIDEVVDED        60
     DEDEAAAPAG SRRRGHAIKS DSEEFEPAEK TEDEPEPPIE DHTAQEVSGP ETRNSKSRGG       120
     PDEDGDESFH EEDAEDEDED ALAGSEDEYL SEESIRRSRR RADRNFVVSD EDDEDEDTIG       180
     ASKRTRRGYR TTTTIDTDED DPPSRRNFRS STIQARQGRR SEISPPRKLR RRARSAYGSE       240
     ERQSRSDRLS LADELRELRD DSPVREKRSL RERTKPVNYT LPPPIGDTAM DETAKLGNAN       300
     GILPYPSPKA RRGLHAGQSF GPLRRLFPTG GPFGGNDVTA IFGTNTNYYD NAGQGTANNK       360
     LLLDSDSSED EILPLGAVST KPNESTHKKK KPEIADLDPL GVDMNIKFED VGGLDNYIDQ       420
     LKEMVALPLL YPELYQKFGI TPPRGVLFHG PPGTGKTLMA RALAASCSTE QQKITFFMRK       480
     GADILSKWVG EAERQLRLLF EEAKKQQPSI IFFDEIDGLA PVRSSKQEQI HASIVSTMLA       540
     LMDGMDNRGQ VIVIGATNRP DAVDPALRRP GRFDREFFFP LPDLSARSKI LEIHTKKWDP       600
     PLPKPFIDRL ASLTKGYGGA DLRALCTEAA LISIQRKVPQ IYQSEMKLSI NLASVNVKAR       660
     DFMMALEKIV PSSARSAGNS AQPIPETVEA LLDSQFEEIK KKLKSIIPSD SKFQRNGAST       720
     IKHYLEYEVE DSDEESDGFS KAEFLRNMEK ARVCKPRLIV TGSRGNGQQY VGAAILHYLE       780
     DFNMQMLDVG TLASDSTRSF ETAIVQIFTE ARRRQPSVLY IPNSEIWLQA VPENAILMLA       840
     SLLRSLRSDE KVLLLAVANG LSKSDILEGS LSHLEFEKFI HKIRKPSSSQ RAKYFLSLKQ       900
     ILKTKPSSFE QGKKRTKPLP QLPVVESSKK SEGLDKNGNP LSEEAKLIQT LKSFQNHDMK       960
     LKNTLKLKLS GLMDLFKNRY KRFRKPPIDD ALLIHLFETN AALQGNPDYQ PAYIKENNMI      1020
     LECATGRRFF NMDLDIVEER LWNGFYSEPR QFLKDIELIY KDAHTSGDRE RIIKASEMFV      1080
     NAQMGIEEIS APDFVMECRD SRQRELTRQK LNLEKQAKLK SQELSEELQV RANEVDISEN      1140
     DLSSSSEKFE RNSLNGSHAL QVGVGSGGQL QCQAQKNPQE ELQVEDATND EQGNNTERQL      1200
     PNDDINPLQI GNNEYKKDDA EAAEIEGAID GKHAESETPR NSSPENSKSS EQSSLSEEAL      1260
     IEEGGPQVAE FILDDNKLND LLSLLEHRSE GFTVQKLEEL YAFALNIIWE DRLLWDRTTT      1320
     LHKLLTHIEN WGN                                                         1333
//

If you have problems or comments...

PBIL Back to PBIL home page