(data stored in ACNUC8465 zone)

EMBL: CU928166.PE385

CU928166.PE385       Location/Qualifiers
FT   CDS             complement(756449..757042)
FT                   /locus_tag="KLTH0B09240g"
FT                   /old_locus_tag="KLTH-ORF14642"
FT                   /product="KLTH0B09240p"
FT                   /note="similar to uniprot|Q03559 YMR295C Saccharomyces
FT                   cerevisiae Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21750"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD89"
FT                   /protein_id="CAR21750.1"
FT                   /translation="MGLFRKSSNASTGAGHLHAPDTKLTKEDREHFKLRASSVHDPVLE
FT                   AVQEAQPFEQAADVSQDDPNRKSYYSGDGPDHLTRDVFGQPIQQPDISNPMRARDERPL
FT                   DTIRGFEYSISGDPSWGQRLETHQYGFRVRPDFPQFGNSGDAMAASGPGGMPSSQFMMQ
FT                   EQAIYSAPAPGSALNPSKKKKKRGLFGRKKDTAE"
     MGLFRKSSNA STGAGHLHAP DTKLTKEDRE HFKLRASSVH DPVLEAVQEA QPFEQAADVS        60
     QDDPNRKSYY SGDGPDHLTR DVFGQPIQQP DISNPMRARD ERPLDTIRGF EYSISGDPSW       120
     GQRLETHQYG FRVRPDFPQF GNSGDAMAAS GPGGMPSSQF MMQEQAIYSA PAPGSALNPS       180
     KKKKKRGLFG RKKDTAE                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page