(data stored in SCRATCH zone)

EMBL: CU928166.PE389

CU928166.PE389       Location/Qualifiers
FT   CDS             765494..767071
FT                   /locus_tag="KLTH0B09328g"
FT                   /old_locus_tag="KLTH-ORF14621"
FT                   /product="KLTH0B09328p"
FT                   /note="similar to uniprot|P00729 Saccharomyces cerevisiae
FT                   YMR297W PRC1 Vacuolar carboxypeptidase Y (proteinase C)
FT                   involved in protein degradation in the vacuole and required
FT                   for full protein degradation during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21754"
FT                   /db_xref="GOA:C5DD93"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD93"
FT                   /protein_id="CAR21754.1"
FT                   /translation="MKTSTLLAGALAASAQAASVQNVFQANTLLDKAIDALGLSSEDVL
FT                   DSLPKSLKSVWGEMGMLFPKETSQLEFVTKPKFKTNRRPDSQWDFVVQENPSHKLRVNK
FT                   IKDPQVLGVDPGVKQYTGYLDVEEEDKHFFYWFFESRNDPKNDPVILWLNGGPGCSSLT
FT                   GQFFELGPSHIGPEIKPIYNPYSWNSNASVIFLDQPVNVGYSYSGSSGVSNTVAAGKDV
FT                   YAFLQLFFKQFPEYASGQDFHIAGESYAGHYIPVFASEILSHPEEERSFNLTSVLIGNG
FT                   LTDELTQYQYYEPMACGEGGEPSVLEPEECEGMLDTLPRCLSLIEACYDSQSVWTCVPA
FT                   SIYCNNAQMGPYQKTGKNVYDIRKECEGELCYAEMSYMDEYLNLDVVKEAVGAEVDKFE
FT                   SCNFDINRNFLFAGDWMKPYHKAVTDLLNQGLPVLIYAGDKDFICNWLGNQAWSNVLPW
FT                   KYGDEFQDAPVKDWISSTTGDTAGKVKNYEHFTFLRVYGGGHMVPYDQPENSLAMVNDW
FT                   IQGRYSFE"
     MKTSTLLAGA LAASAQAASV QNVFQANTLL DKAIDALGLS SEDVLDSLPK SLKSVWGEMG        60
     MLFPKETSQL EFVTKPKFKT NRRPDSQWDF VVQENPSHKL RVNKIKDPQV LGVDPGVKQY       120
     TGYLDVEEED KHFFYWFFES RNDPKNDPVI LWLNGGPGCS SLTGQFFELG PSHIGPEIKP       180
     IYNPYSWNSN ASVIFLDQPV NVGYSYSGSS GVSNTVAAGK DVYAFLQLFF KQFPEYASGQ       240
     DFHIAGESYA GHYIPVFASE ILSHPEEERS FNLTSVLIGN GLTDELTQYQ YYEPMACGEG       300
     GEPSVLEPEE CEGMLDTLPR CLSLIEACYD SQSVWTCVPA SIYCNNAQMG PYQKTGKNVY       360
     DIRKECEGEL CYAEMSYMDE YLNLDVVKEA VGAEVDKFES CNFDINRNFL FAGDWMKPYH       420
     KAVTDLLNQG LPVLIYAGDK DFICNWLGNQ AWSNVLPWKY GDEFQDAPVK DWISSTTGDT       480
     AGKVKNYEHF TFLRVYGGGH MVPYDQPENS LAMVNDWIQG RYSFE                       525
//

If you have problems or comments...

PBIL Back to PBIL home page