(data stored in SCRATCH zone)

EMBL: CU928166.PE390

CU928166.PE390       Location/Qualifiers
FT   CDS             767386..767808
FT                   /locus_tag="KLTH0B09350g"
FT                   /old_locus_tag="KLTH-ORF14617"
FT                   /product="KLTH0B09350p"
FT                   /note="similar to uniprot|Q03579 Saccharomyces cerevisiae
FT                   YMR298W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09350g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21755"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD94"
FT                   /protein_id="CAR21755.1"
FT                   /translation="MAQRTPQIYKLFQYVCAGLALIAAVEYFKYSTRINYEWFHCTLVE
FT                   EPWEQGSSLSRLYAVGGPSCDKRGELKTIMKKITRGFDLQKEGISFCIKEDLEVPSVHY
FT                   PIHDKKGAPGYVAYASYDSDSRDIREVCEDAPVLHI"
     MAQRTPQIYK LFQYVCAGLA LIAAVEYFKY STRINYEWFH CTLVEEPWEQ GSSLSRLYAV        60
     GGPSCDKRGE LKTIMKKITR GFDLQKEGIS FCIKEDLEVP SVHYPIHDKK GAPGYVAYAS       120
     YDSDSRDIRE VCEDAPVLHI                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page