(data stored in SCRATCH zone)

EMBL: CU928166.PE391

CU928166.PE391       Location/Qualifiers
FT   CDS             complement(767865..770873)
FT                   /locus_tag="KLTH0B09372g"
FT                   /old_locus_tag="KLTH-ORF14615"
FT                   /product="KLTH0B09372p"
FT                   /note="similar to uniprot|P46677 YGR274C Saccharomyces
FT                   cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
FT                   polymerase II transcription initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09372g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21756"
FT                   /db_xref="InterPro:IPR022591"
FT                   /db_xref="InterPro:IPR040240"
FT                   /db_xref="InterPro:IPR041670"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD95"
FT                   /protein_id="CAR21756.1"
FT                   /translation="MSSRKQTKKQLPGKGDLTNEDDAYDAVFSGEFGSMEIGNYIGPSE
FT                   GQTEHLPDAIDFEDEDELAEEELPEETQPSMRNMTQEDDDYLNMMSNGAILGEQADGYS
FT                   DRNNTLFMGVDGHEATFPEEHHPFGEFADENQIALEEQRKLLEKERVAREEKELLNYYF
FT                   PKFQKGKVLSLMSIVPKQISKYQWQRDLYLTNRHIKPMLPLKLRVEVQPDSRRLFKSKS
FT                   KSWQFMSELYKKKKPGLVTVPLEDMFADGKQSTQRRKMDGSIPSELMMIADEWDYKKII
FT                   GDSDDEQESQSGKSTRSVAVSSETPTIQQDWNWDEENLVEGKVDQIKVCLDMNDERLLF
FT                   VKDKHQEHQESKAKPALLPFNEKSLLQKFNISNDDKYKILKENYQTKIRSTISNLSIEH
FT                   SQPAFRLQSPFFKVVPPKGYIRHFHRPHFGGQVRPGTNIVFSKVKTRKRKRDKGKDVRE
FT                   LFARSPDLTLGDSAPIFLMEYSEESPVALSKFGMGNKLINYYRKTDEKDLSRPKLPVGE
FT                   THVLGVQDKSPFWNFGFVEPGNVVPTLYNNMIRAPVFKHEVSGTDFLLIKSTGNGMGNR
FT                   FYLRNINHLFTVGQTFPVVEVPGPNSRRVTSMGKNRLRMIVYRILNKSAEHRLLVKQVA
FT                   RHFPDQNDMQNRQRLKEFMKYQRDGDDHGFWKLKESEILPDNENVKKMITPEDVSLTES
FT                   MYQGQQFQEDNEFFNCDEKLIKLEENLIPWAATKNFLNATQMRAMVQIHGAGDPTGCGE
FT                   GFSFLKTSMKGGFTRSGDDSGQPQISGGHSYNVAQQQKAYEEEISKTWYTQAKSLRITN
FT                   PFEEMEDPDVVNKTNKKVKSHRDDNKVLRIIRKKRDENGIIQRQTIIIKDPRVIQGYLR
FT                   AYKKKREEAEANLGLEELMNDNIDLVSGGNTEEKQLKQKKLLEEQLAKLQKSQERRQAR
FT                   KLAKEKTKDGKVTKARNTNRRCATCGMVGHIRTNKTCPMYNGGTGAAIANPPTPGPAPG
FT                   SENSVENAENAEA"
     MSSRKQTKKQ LPGKGDLTNE DDAYDAVFSG EFGSMEIGNY IGPSEGQTEH LPDAIDFEDE        60
     DELAEEELPE ETQPSMRNMT QEDDDYLNMM SNGAILGEQA DGYSDRNNTL FMGVDGHEAT       120
     FPEEHHPFGE FADENQIALE EQRKLLEKER VAREEKELLN YYFPKFQKGK VLSLMSIVPK       180
     QISKYQWQRD LYLTNRHIKP MLPLKLRVEV QPDSRRLFKS KSKSWQFMSE LYKKKKPGLV       240
     TVPLEDMFAD GKQSTQRRKM DGSIPSELMM IADEWDYKKI IGDSDDEQES QSGKSTRSVA       300
     VSSETPTIQQ DWNWDEENLV EGKVDQIKVC LDMNDERLLF VKDKHQEHQE SKAKPALLPF       360
     NEKSLLQKFN ISNDDKYKIL KENYQTKIRS TISNLSIEHS QPAFRLQSPF FKVVPPKGYI       420
     RHFHRPHFGG QVRPGTNIVF SKVKTRKRKR DKGKDVRELF ARSPDLTLGD SAPIFLMEYS       480
     EESPVALSKF GMGNKLINYY RKTDEKDLSR PKLPVGETHV LGVQDKSPFW NFGFVEPGNV       540
     VPTLYNNMIR APVFKHEVSG TDFLLIKSTG NGMGNRFYLR NINHLFTVGQ TFPVVEVPGP       600
     NSRRVTSMGK NRLRMIVYRI LNKSAEHRLL VKQVARHFPD QNDMQNRQRL KEFMKYQRDG       660
     DDHGFWKLKE SEILPDNENV KKMITPEDVS LTESMYQGQQ FQEDNEFFNC DEKLIKLEEN       720
     LIPWAATKNF LNATQMRAMV QIHGAGDPTG CGEGFSFLKT SMKGGFTRSG DDSGQPQISG       780
     GHSYNVAQQQ KAYEEEISKT WYTQAKSLRI TNPFEEMEDP DVVNKTNKKV KSHRDDNKVL       840
     RIIRKKRDEN GIIQRQTIII KDPRVIQGYL RAYKKKREEA EANLGLEELM NDNIDLVSGG       900
     NTEEKQLKQK KLLEEQLAKL QKSQERRQAR KLAKEKTKDG KVTKARNTNR RCATCGMVGH       960
     IRTNKTCPMY NGGTGAAIAN PPTPGPAPGS ENSVENAENA EA                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page