(data stored in SCRATCH zone)

EMBL: CU928166.PE400

CU928166.PE400       Location/Qualifiers
FT   CDS             783747..785033
FT                   /locus_tag="KLTH0B09570g"
FT                   /old_locus_tag="KLTH-ORF14596"
FT                   /product="KLTH0B09570p"
FT                   /note="highly similar to uniprot|P32527 Saccharomyces
FT                   cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
FT                   chaperone contains a DnaJ domain together with Ssz1p acts
FT                   as a chaperone for nascent polypeptide chains"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09570g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21765"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR032003"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA4"
FT                   /protein_id="CAR21765.1"
FT                   /translation="MISLPPLTSDINVNVNTSASKAASVRRPVEPVGRFFMHHAQRTLR
FT                   NHTWSEFEKIQASQNVQRVDESVDPDEELLDDELADESLLEHDPRDWKTADLYAAMGLS
FT                   KLRHKATDAQVIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYETLTDPTKRKQYD
FT                   SCDYNADVEPPKKGSKYDFFEAWGPVFEAESRFSKKQPVVLLGGPDASKADVEKFYNFW
FT                   HRFDSWRTFEFADEEVPDDSSNRDHKRYIERKNKAARDKKKTADNARLAKLVERASNED
FT                   PRIKQFKEAEKKEKEKKKWEREAGARAEAEAKAKAEAEAKAKAEAEAAAAAGAKVDKKK
FT                   AKEAAKAAKKKNKRAVRNAPKDADYFGDAEKAAAIDEQTGLIVDSVDDEQLVQLAEKVK
FT                   ADAKAGLAEFAKVLSDSGKLPASLLSYFL"
     MISLPPLTSD INVNVNTSAS KAASVRRPVE PVGRFFMHHA QRTLRNHTWS EFEKIQASQN        60
     VQRVDESVDP DEELLDDELA DESLLEHDPR DWKTADLYAA MGLSKLRHKA TDAQVIKAHR       120
     KQVLKHHPDK KSASGGLEQD GFFKIIQKAY ETLTDPTKRK QYDSCDYNAD VEPPKKGSKY       180
     DFFEAWGPVF EAESRFSKKQ PVVLLGGPDA SKADVEKFYN FWHRFDSWRT FEFADEEVPD       240
     DSSNRDHKRY IERKNKAARD KKKTADNARL AKLVERASNE DPRIKQFKEA EKKEKEKKKW       300
     EREAGARAEA EAKAKAEAEA KAKAEAEAAA AAGAKVDKKK AKEAAKAAKK KNKRAVRNAP       360
     KDADYFGDAE KAAAIDEQTG LIVDSVDDEQ LVQLAEKVKA DAKAGLAEFA KVLSDSGKLP       420
     ASLLSYFL                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page