(data stored in SCRATCH zone)

EMBL: CU928166.PE402

CU928166.PE402       Location/Qualifiers
FT   CDS             786773..787390
FT                   /locus_tag="KLTH0B09614g"
FT                   /old_locus_tag="KLTH-ORF14587"
FT                   /product="KLTH0B09614p"
FT                   /note="similar to uniprot|P41818 Saccharomyces cerevisiae
FT                   YMR311C GLC8 Regulatory subunit of protein phosphatase 1
FT                   (Glc7p) involved in glycogen metabolism and chromosome
FT                   segregation proposed to regulate Glc7p activity via
FT                   conformational alteration ortholog of the mammalian protein
FT                   phosphatase inhibitor 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21767"
FT                   /db_xref="GOA:C5DDA6"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA6"
FT                   /protein_id="CAR21767.1"
FT                   /translation="MVGILKNPLPDRNGESEEPESISEFRKQVYKNTQLNAKLTSKAQN
FT                   NGKSTSKANAASPKRPVVPRDTLSLKHQHDTLSQAEEEKLKWNQQNLAENDIAKLEYKD
FT                   INIDEPKTPYQGAVDPTGEYYRDDDDELESLSLGEPVVEMPQSDSDNSSSSGPSDAEPS
FT                   AEESAEAKHRRFEELRKKHYNVKEALKAQRQNLDDEELEDED"
     MVGILKNPLP DRNGESEEPE SISEFRKQVY KNTQLNAKLT SKAQNNGKST SKANAASPKR        60
     PVVPRDTLSL KHQHDTLSQA EEEKLKWNQQ NLAENDIAKL EYKDINIDEP KTPYQGAVDP       120
     TGEYYRDDDD ELESLSLGEP VVEMPQSDSD NSSSSGPSDA EPSAEESAEA KHRRFEELRK       180
     KHYNVKEALK AQRQNLDDEE LEDED                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page