(data stored in ACNUC8465 zone)

EMBL: CU928166.PE404

CU928166.PE404       Location/Qualifiers
FT   CDS             789016..789939
FT                   /locus_tag="KLTH0B09658g"
FT                   /old_locus_tag="KLTH-ORF14583"
FT                   /product="KLTH0B09658p"
FT                   /note="highly similar to uniprot|P15703 Saccharomyces
FT                   cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
FT                   protein of the cell wall involved in cell wall maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21769"
FT                   /db_xref="GOA:C5DDA8"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA8"
FT                   /protein_id="CAR21769.1"
FT                   /translation="MKFSTIASLAAVGVSYASAVGDLGFNLGVKNNDGTCKSTEDYAKD
FT                   LDILKGYTSTVKVYAASDCNTLQNLGPAAESAGFSVFVGVWPNDDAHFSAEKQALQSYL
FT                   PNIKTSTVKGILVGSEALYREDLTASELASKISEVKSLVADIKDSDGNSYSGTLVGTVD
FT                   SWNVLVDGGNADVIKASDMVMANAFSYWQGQTMDNASYSFFDDIMQAMQTIQTVKGTDI
FT                   PFWVGETGWPTDGTNFESSYPGTDNAAQFWQEGICAIRAWGVNVLVFEAFDEDWKPNTS
FT                   GTSDVEKHWGVWTSGDELKYSLDCKF"
     MKFSTIASLA AVGVSYASAV GDLGFNLGVK NNDGTCKSTE DYAKDLDILK GYTSTVKVYA        60
     ASDCNTLQNL GPAAESAGFS VFVGVWPNDD AHFSAEKQAL QSYLPNIKTS TVKGILVGSE       120
     ALYREDLTAS ELASKISEVK SLVADIKDSD GNSYSGTLVG TVDSWNVLVD GGNADVIKAS       180
     DMVMANAFSY WQGQTMDNAS YSFFDDIMQA MQTIQTVKGT DIPFWVGETG WPTDGTNFES       240
     SYPGTDNAAQ FWQEGICAIR AWGVNVLVFE AFDEDWKPNT SGTSDVEKHW GVWTSGDELK       300
     YSLDCKF                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page