(data stored in SCRATCH zone)

EMBL: CU928166.PE408

CU928166.PE408       Location/Qualifiers
FT   CDS             805761..809039
FT                   /locus_tag="KLTH0B09768g"
FT                   /old_locus_tag="KLTH-ORF14534"
FT                   /product="KLTH0B09768p"
FT                   /note="similar to uniprot|P32337 Saccharomyces cerevisiae
FT                   YMR308C PSE1 Karyopherin/importin that interacts with the
FT                   nuclear pore complex acts as the nuclear import receptor
FT                   for specific proteins including Pdr1p Yap1p Ste12p and
FT                   Aft1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21773"
FT                   /db_xref="GOA:C5DDB2"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="InterPro:IPR040928"
FT                   /db_xref="InterPro:IPR041389"
FT                   /db_xref="InterPro:IPR041653"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB2"
FT                   /protein_id="CAR21773.1"
FT                   /translation="MSALPDEVNTTLVNVLHGFSSPDNGIRAAAEETLNKDWITPDNIE
FT                   VLLIFLSEQAAYSPEPTLAALSAVLFRKLALRAPPSSKTVIIAKNITHISESALNQIRE
FT                   TLLKGFVTERQGGIRHKLSDAIAECAQEDLPEWPALLQGLFEAIKNPDANFRESSFRIF
FT                   TSVPHLINAVDINSVLPIFEAGFTDSDDNVKVAAVTAFVGYFKQLPKQHWAKLGILLPS
FT                   LLNSLPNFLDGGKDDALASVFESLIELVELAPKLFKNMFDQMIQFTDIVIKNKDLETSA
FT                   RTTALELLTAFSESAPQMCKSTPSYAQSLIMNTLLMMTEVSIDDDQASDWHDSDDTEED
FT                   DEEVTYDHARQALDRVSLKLGGKYLAPPLFQYLQQMVSSSEWRERFGALMALSSAAEGC
FT                   RDVLIGEIPKILDMIVPLINDPHPRVQYGCCNALGQISTDFAPLIQRTSHERILPPLIS
FT                   KLTPQSVDRVQTHAAAALVNFSEHATQTILEPYLDDLLTNLLTLLQSTKFYVQEQALTT
FT                   IAFIAEAAEKKFIKYYDTLMPLLINVLKTDTGNANRLLKGKCIECSTLIALAVGKEKFL
FT                   TQSQELIELFIAYQNQGIDDDDPMKSYLEHGWSRICRILREDFVPLLPVVIPPLLETAK
FT                   ATQDVSLIEEEDAANFQQYSDWDVVQIQGKHIAIHTSILDDKVSAMELLQVYTTILKNF
FT                   FAVYVPEIMKEIAVPSIDFYLHDGVRATGAGLIPVLLSALVSATGVQNSDVLQLWHLAS
FT                   TKLLNGIISEPMPEITQIYHTALVDGLAIMGENSLSDEQLLQYTKGLSANLSDIYERVK
FT                   QRRNQEDEYNEDVDDDFEDYTDEDLLDDINKSLAAVFKSTGGRYLNQFQTLWPLVVTYL
FT                   RDGEVILTLFALCAIGDMIETAGPATEVYKDSFINEVKEYLVSPEASIRQAAAYVIGVC
FT                   AQHSRDVYAQECSQSLDTLVRVISIPDAKSEENVTSTENASAAIAKILHSYGPNVPNFD
FT                   NYVSNWLKTFPIVQDEEAAAFNYRFLAHLIDSNSPAVHNSAAIPHILDSVVQALHHKSL
FT                   VGKNASAVVESTKKLLGTLPQSEAMNLFQRYPSDVVQEVQHWFA"
     MSALPDEVNT TLVNVLHGFS SPDNGIRAAA EETLNKDWIT PDNIEVLLIF LSEQAAYSPE        60
     PTLAALSAVL FRKLALRAPP SSKTVIIAKN ITHISESALN QIRETLLKGF VTERQGGIRH       120
     KLSDAIAECA QEDLPEWPAL LQGLFEAIKN PDANFRESSF RIFTSVPHLI NAVDINSVLP       180
     IFEAGFTDSD DNVKVAAVTA FVGYFKQLPK QHWAKLGILL PSLLNSLPNF LDGGKDDALA       240
     SVFESLIELV ELAPKLFKNM FDQMIQFTDI VIKNKDLETS ARTTALELLT AFSESAPQMC       300
     KSTPSYAQSL IMNTLLMMTE VSIDDDQASD WHDSDDTEED DEEVTYDHAR QALDRVSLKL       360
     GGKYLAPPLF QYLQQMVSSS EWRERFGALM ALSSAAEGCR DVLIGEIPKI LDMIVPLIND       420
     PHPRVQYGCC NALGQISTDF APLIQRTSHE RILPPLISKL TPQSVDRVQT HAAAALVNFS       480
     EHATQTILEP YLDDLLTNLL TLLQSTKFYV QEQALTTIAF IAEAAEKKFI KYYDTLMPLL       540
     INVLKTDTGN ANRLLKGKCI ECSTLIALAV GKEKFLTQSQ ELIELFIAYQ NQGIDDDDPM       600
     KSYLEHGWSR ICRILREDFV PLLPVVIPPL LETAKATQDV SLIEEEDAAN FQQYSDWDVV       660
     QIQGKHIAIH TSILDDKVSA MELLQVYTTI LKNFFAVYVP EIMKEIAVPS IDFYLHDGVR       720
     ATGAGLIPVL LSALVSATGV QNSDVLQLWH LASTKLLNGI ISEPMPEITQ IYHTALVDGL       780
     AIMGENSLSD EQLLQYTKGL SANLSDIYER VKQRRNQEDE YNEDVDDDFE DYTDEDLLDD       840
     INKSLAAVFK STGGRYLNQF QTLWPLVVTY LRDGEVILTL FALCAIGDMI ETAGPATEVY       900
     KDSFINEVKE YLVSPEASIR QAAAYVIGVC AQHSRDVYAQ ECSQSLDTLV RVISIPDAKS       960
     EENVTSTENA SAAIAKILHS YGPNVPNFDN YVSNWLKTFP IVQDEEAAAF NYRFLAHLID      1020
     SNSPAVHNSA AIPHILDSVV QALHHKSLVG KNASAVVEST KKLLGTLPQS EAMNLFQRYP      1080
     SDVVQEVQHW FA                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page