(data stored in ACNUC8465 zone)

EMBL: CU928166.PE409

CU928166.PE409       Location/Qualifiers
FT   CDS             809351..810328
FT                   /locus_tag="KLTH0B09790g"
FT                   /old_locus_tag="KLTH-ORF14531"
FT                   /product="KLTH0B09790p"
FT                   /note="some similarities with uniprot|P53335 Saccharomyces
FT                   cerevisiae YGR280C PXR1 Protein with a role in maturation
FT                   of rRNAs and small nucleolar RNAs required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21774"
FT                   /db_xref="GOA:C5DDB3"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB3"
FT                   /protein_id="CAR21774.1"
FT                   /translation="MGLAATKNKQKLGLDPRNTAWSNDTSRFGHKHLEKMGWRPGSGLG
FT                   MMPNATTTHVKVSIKDDNLGLGAKLRKKDKADEFDSGECAGLDAFQRLLGRLNGKEDSV
FT                   SNELDIQKKQNIINGKWGIHFVKGDVLASTWDAKTKTLKLYSNESTKRKLDSEDEEYPS
FT                   SRESKRSKKSKESRKSDKKKDVSEEDKETVKKGDKSRKDKDKKLKKDGDTKDKKEKRVK
FT                   KEKKDKKDKKDKHKMKKTEDKKQKHKKSEKDRDEKHKNKKDKKREYKSSKSNKVSRESM
FT                   LKPRDPQENAIASRLSVRSKWIKQKRAAVMDAQALNEIFMVTTQ"
     MGLAATKNKQ KLGLDPRNTA WSNDTSRFGH KHLEKMGWRP GSGLGMMPNA TTTHVKVSIK        60
     DDNLGLGAKL RKKDKADEFD SGECAGLDAF QRLLGRLNGK EDSVSNELDI QKKQNIINGK       120
     WGIHFVKGDV LASTWDAKTK TLKLYSNEST KRKLDSEDEE YPSSRESKRS KKSKESRKSD       180
     KKKDVSEEDK ETVKKGDKSR KDKDKKLKKD GDTKDKKEKR VKKEKKDKKD KKDKHKMKKT       240
     EDKKQKHKKS EKDRDEKHKN KKDKKREYKS SKSNKVSRES MLKPRDPQEN AIASRLSVRS       300
     KWIKQKRAAV MDAQALNEIF MVTTQ                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page