(data stored in SCRATCH zone)

EMBL: CU928166.PE412

CU928166.PE412       Location/Qualifiers
FT   CDS             complement(815242..820530)
FT                   /locus_tag="KLTH0B09856g"
FT                   /old_locus_tag="KLTH-ORF14517"
FT                   /product="KLTH0B09856p"
FT                   /note="similar to uniprot|Q04952 Saccharomyces cerevisiae
FT                   YMR306W FKS3 Protein of unknown function has similarity to
FT                   1,3-beta-D-glucan synthase catalytic subunits Fks1p and
FT                   Gsc2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09856g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21777"
FT                   /db_xref="GOA:C5DDB6"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="InterPro:IPR026899"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB6"
FT                   /protein_id="CAR21777.1"
FT                   /translation="MEDEQFSAWYHDGEAPVTRTELRDIFDDLARKFGFQQSSKENMQQ
FT                   HMLAQLDSRARRSSARTALTSLHASYIGGDEANFKKWYFAAQLDLDEEIGFQNLKLHGK
FT                   ARKRNLKHAKERGVSIEEQIRLWKEQEEEFANSHPKLPFTQTQPKINESFATADYKWKL
FT                   RMRDLEPGQMARQLALYFLCWGEANQIRFTPECLCFIFKCALDHDVSEADVCQASKPEF
FT                   SYLDDIITPLYRFLRSQVYHVDETNGKMTRLEKDHKDIIGYDDVNQLFWYPEGIERLVL
FT                   ESGERLIDKPSHERYLSLKDVLWSKAFYKTYKETRTWMHCATNFNRIWIIHLSTFWFFT
FT                   SFNAPTLYTKDYVQLLNNPPTRQARLSAVALGGTLTCIIQIVATLFEWSFVPRKWPGGQ
FT                   HLTRRMIALLVCLAINFAPSVYVFGFFDLDVHSTYAYTASIIQLIIAIVTTFFFAIRPL
FT                   GGLFESYLFKGRKKRRYTSSQTFTAQFPKLMGRSRWFSWGLWFFVFLGKFIESYFFLTL
FT                   SLRDPIRVLSIMDMSRCNGDSLLGSHLCRLQPKITLIIMILTDLVLFFLDTYLWYIICN
FT                   CIFSIILSFSLGTSILTPWKNIYSRLPKRIHSKILATSEMDVKYKPKILVSQIWNAMII
FT                   SMYREHLLSIEHVQRLLYQQVDSANMNKRTLKSPTFFVAQDDSTFKSMDFFPENSEAER
FT                   RISFFAQSLSTPISEPIPVECMPTFTVLIPHYSEKILLSLKEIIKEESTKSRITLLEYL
FT                   KYLYPTEWECFVRDTKLIAVENCSINNDQGESESEVLKEGLLGVSKEYDDRSKFFQAKI
FT                   EDLPYHCMGFTNSDPEYTLRTRIWASLRFQTLYRTVSGFMNYSKAIKLLYRIENPTIIQ
FT                   KYGADFELLEEELDRLSREKFRMVVAMQRLKKFDRHEREAAEFLLKAYPDMCISYLEEV
FT                   PQENGEAIFYSCLIDGHCDFEDTTGERKPQFKIRLSGNPILGDGKSDNQNHSLIFYRGE
FT                   YIQVIDANQDNYLEECLKIRSILGEFEELDLDQSMPYIPGVDSGGDAPIAIVGAREYIF
FT                   SENIGVLGDIAAGKEQTFGTLFARTLAEIGGKLHYGHPDFLNGIFMTTRGGISKAQKGL
FT                   HLNEDIYAGMTAVCRGGRIKHSDYYQCGKGRDLGFGSIMNFTTKIGAGMGEQLLSREYY
FT                   YLGTQLPIDRFLSFFYAHAGFHLNNLFITMSVQIFFILLINLGSLNHEVIRCEYNKDLP
FT                   ITDLERPIGCYNILPVLHWVNIFVLSIFIVFFIAFAPLLIQELLEKGAWKAFSRLIHHL
FT                   FSLAPLFEVFVCQIYARSLLTNVTFGGAKYISTGRGFAITRLDFPELYSKFANTSIYAG
FT                   SKIFLMLLFATVSMWQPALLWFWITVVSMCLAPFLFNPHQFAFTDFFVDYRNFIHWLSR
FT                   GNSKYERKSWIEHVRSSRAVFTGYKRKIVGDISEESASETRRAQISDVFAAEVIIPLLT
FT                   AGLSFTAYTFINAQTGVPSATATSAVIRLGIVTFLPIFVNFIVLFVCFQLSFFAAPLLS
FT                   LCCKKVGATIAAIVHGFAVVIYLITFEVMWCLEGWSFTRALTLLIACISIQNFVFKVIT
FT                   IFFLTREYRNNKSQLAWWSGKWFTTGIGWIAVLQPSRELFVKTIECSLFAGDFILGHLI
FT                   LFVQLPLVFTPFVNYWHSMMLFWMKPKSLISNKLAYTKKQKLRRRRIVQKYLPIHCLIL
FT                   FLFIGLLVAPFYTAKNLPLGPDTFKNSFLDGLIQPKSQDNNDTGTRAPSYILTTTPPMP
FT                   VFRTVR"
     MEDEQFSAWY HDGEAPVTRT ELRDIFDDLA RKFGFQQSSK ENMQQHMLAQ LDSRARRSSA        60
     RTALTSLHAS YIGGDEANFK KWYFAAQLDL DEEIGFQNLK LHGKARKRNL KHAKERGVSI       120
     EEQIRLWKEQ EEEFANSHPK LPFTQTQPKI NESFATADYK WKLRMRDLEP GQMARQLALY       180
     FLCWGEANQI RFTPECLCFI FKCALDHDVS EADVCQASKP EFSYLDDIIT PLYRFLRSQV       240
     YHVDETNGKM TRLEKDHKDI IGYDDVNQLF WYPEGIERLV LESGERLIDK PSHERYLSLK       300
     DVLWSKAFYK TYKETRTWMH CATNFNRIWI IHLSTFWFFT SFNAPTLYTK DYVQLLNNPP       360
     TRQARLSAVA LGGTLTCIIQ IVATLFEWSF VPRKWPGGQH LTRRMIALLV CLAINFAPSV       420
     YVFGFFDLDV HSTYAYTASI IQLIIAIVTT FFFAIRPLGG LFESYLFKGR KKRRYTSSQT       480
     FTAQFPKLMG RSRWFSWGLW FFVFLGKFIE SYFFLTLSLR DPIRVLSIMD MSRCNGDSLL       540
     GSHLCRLQPK ITLIIMILTD LVLFFLDTYL WYIICNCIFS IILSFSLGTS ILTPWKNIYS       600
     RLPKRIHSKI LATSEMDVKY KPKILVSQIW NAMIISMYRE HLLSIEHVQR LLYQQVDSAN       660
     MNKRTLKSPT FFVAQDDSTF KSMDFFPENS EAERRISFFA QSLSTPISEP IPVECMPTFT       720
     VLIPHYSEKI LLSLKEIIKE ESTKSRITLL EYLKYLYPTE WECFVRDTKL IAVENCSINN       780
     DQGESESEVL KEGLLGVSKE YDDRSKFFQA KIEDLPYHCM GFTNSDPEYT LRTRIWASLR       840
     FQTLYRTVSG FMNYSKAIKL LYRIENPTII QKYGADFELL EEELDRLSRE KFRMVVAMQR       900
     LKKFDRHERE AAEFLLKAYP DMCISYLEEV PQENGEAIFY SCLIDGHCDF EDTTGERKPQ       960
     FKIRLSGNPI LGDGKSDNQN HSLIFYRGEY IQVIDANQDN YLEECLKIRS ILGEFEELDL      1020
     DQSMPYIPGV DSGGDAPIAI VGAREYIFSE NIGVLGDIAA GKEQTFGTLF ARTLAEIGGK      1080
     LHYGHPDFLN GIFMTTRGGI SKAQKGLHLN EDIYAGMTAV CRGGRIKHSD YYQCGKGRDL      1140
     GFGSIMNFTT KIGAGMGEQL LSREYYYLGT QLPIDRFLSF FYAHAGFHLN NLFITMSVQI      1200
     FFILLINLGS LNHEVIRCEY NKDLPITDLE RPIGCYNILP VLHWVNIFVL SIFIVFFIAF      1260
     APLLIQELLE KGAWKAFSRL IHHLFSLAPL FEVFVCQIYA RSLLTNVTFG GAKYISTGRG      1320
     FAITRLDFPE LYSKFANTSI YAGSKIFLML LFATVSMWQP ALLWFWITVV SMCLAPFLFN      1380
     PHQFAFTDFF VDYRNFIHWL SRGNSKYERK SWIEHVRSSR AVFTGYKRKI VGDISEESAS      1440
     ETRRAQISDV FAAEVIIPLL TAGLSFTAYT FINAQTGVPS ATATSAVIRL GIVTFLPIFV      1500
     NFIVLFVCFQ LSFFAAPLLS LCCKKVGATI AAIVHGFAVV IYLITFEVMW CLEGWSFTRA      1560
     LTLLIACISI QNFVFKVITI FFLTREYRNN KSQLAWWSGK WFTTGIGWIA VLQPSRELFV      1620
     KTIECSLFAG DFILGHLILF VQLPLVFTPF VNYWHSMMLF WMKPKSLISN KLAYTKKQKL      1680
     RRRRIVQKYL PIHCLILFLF IGLLVAPFYT AKNLPLGPDT FKNSFLDGLI QPKSQDNNDT      1740
     GTRAPSYILT TTPPMPVFRT VR                                               1762
//

If you have problems or comments...

PBIL Back to PBIL home page