(data stored in SCRATCH zone)

EMBL: CU928166.PE414

CU928166.PE414       Location/Qualifiers
FT   CDS             complement(823250..825040)
FT                   /locus_tag="KLTH0B09900g"
FT                   /old_locus_tag="KLTH-ORF14504"
FT                   /product="KLTH0B09900p"
FT                   /note="similar to uniprot|P53333 Saccharomyces cerevisiae
FT                   YGR278W CWC22 Essential protein component of a complex
FT                   containing Cef1p has similarity to S. pombe Cwf22p putative
FT                   spliceosomal component based on computational analysis of
FT                   large-scale protein-protein interaction data"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09900g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21779"
FT                   /db_xref="GOA:C5DDB8"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR003891"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB8"
FT                   /protein_id="CAR21779.1"
FT                   /translation="MSQEDQDVVILQKESWDHLKSYIKQCFRSLTRSSVVEEYRKLFAV
FT                   NILWGERLVVSSVLQKQSAGDSSEILAALTSLLNAHIPQLGELLIEETTSRFLNAFKTH
FT                   NSKGCYAMAALIAELFNYEVLHEILILQILHLLMEGVNVDSACLAMFVLSKCGRQLMLV
FT                   AKTAHDLAFESLRKFFQENKVERAVYRRFEDLFDLRKRNYPQLSKRIHLPDHETVTHTF
FT                   LLDLESSTPSSDESLEEFRYDRNFMEKESEIETLRSKLFALEGTDATPDEQRPAEDKTQ
FT                   SRELEMKKKIYLTLKGSLSGDEAAHKILKYKFPDSEKKAVVDILVTACSQETTYSKFYG
FT                   IVAERLCSSHKSWKAAFGQSFHDNYSAVDEFQANQVRNMGKFWGHILASDYLGFEVFES
FT                   VHMNANETSSAGRVYLKFLFQELVLDLSIDTLQARLDEPYIQPFLVNLFPKDDAEKSRF
FT                   SINYFTAIGLGRLTEGMRQALADMEKKVVALQDTEAESGSSLFSRRGSSSSPKTKAYIQ
FT                   GERASSETDNSHSLERSYRRPQDEEFSQTRYSESLTRSRTSVRRRSRTPTRRRSRTPTR
FT                   RRSRTPARRRSRSPNTRFGP"
     MSQEDQDVVI LQKESWDHLK SYIKQCFRSL TRSSVVEEYR KLFAVNILWG ERLVVSSVLQ        60
     KQSAGDSSEI LAALTSLLNA HIPQLGELLI EETTSRFLNA FKTHNSKGCY AMAALIAELF       120
     NYEVLHEILI LQILHLLMEG VNVDSACLAM FVLSKCGRQL MLVAKTAHDL AFESLRKFFQ       180
     ENKVERAVYR RFEDLFDLRK RNYPQLSKRI HLPDHETVTH TFLLDLESST PSSDESLEEF       240
     RYDRNFMEKE SEIETLRSKL FALEGTDATP DEQRPAEDKT QSRELEMKKK IYLTLKGSLS       300
     GDEAAHKILK YKFPDSEKKA VVDILVTACS QETTYSKFYG IVAERLCSSH KSWKAAFGQS       360
     FHDNYSAVDE FQANQVRNMG KFWGHILASD YLGFEVFESV HMNANETSSA GRVYLKFLFQ       420
     ELVLDLSIDT LQARLDEPYI QPFLVNLFPK DDAEKSRFSI NYFTAIGLGR LTEGMRQALA       480
     DMEKKVVALQ DTEAESGSSL FSRRGSSSSP KTKAYIQGER ASSETDNSHS LERSYRRPQD       540
     EEFSQTRYSE SLTRSRTSVR RRSRTPTRRR SRTPTRRRSR TPARRRSRSP NTRFGP           596
//

If you have problems or comments...

PBIL Back to PBIL home page