(data stored in SCRATCH zone)

EMBL: CU928166.PE42

CU928166.PE42        Location/Qualifiers
FT   CDS             complement(108265..110865)
FT                   /locus_tag="KLTH0B01232g"
FT                   /old_locus_tag="KLTH-ORF15843"
FT                   /product="KLTH0B01232p"
FT                   /note="similar to uniprot|P46675 Saccharomyces cerevisiae
FT                   YLR045C STU2 Microtubule-associated protein (MAP) of the
FT                   XMAP215/Dis1 family regulates microtubule dynamics during
FT                   spindle orientation and metaphase chromosome alignment
FT                   interacts with spindle pole body component Spc72p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21407"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR024395"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC96"
FT                   /protein_id="CAR21407.1"
FT                   /translation="MADSEDGDFTSLPLSERLDHKLWKARLHGYQELQALFQKASVTSV
FT                   PRELAQYWANPDLFAGYIVDSNVVAQEQAITALQNMLEYLCEFRDTPRSDEMRGRWLPL
FT                   LAEKGLSSSRNSTKAKAQECVLILVSLDRSVEHSIELLEPSLTNKLPRLVANCVECISN
FT                   IVESFGLAQVSNMSGFLPVLLEPLPKLSSHADRNVRSQTMNLILQLYKWLGRDLLQELL
FT                   LEKLKPIQQRDLDKTFGKYDGEIPPTSQPRPFQWQKGLEVQNLEGSKDKDGDTLMGESF
FT                   PDVKAHANPGLPQLDPFELLPVSPVLEKFPLDFMERITSSKWKDRVEVLEEILNQVLIP
FT                   TKKFEAKGQDYSDFLRAVAHVIEKDANVQAVTLAAQCVQQLCQKLKANFTRSYGSIVLR
FT                   SLLERSKEKKASVNEAICEALNNIADCCGVDACLEDNLSFINHKTPQVRTESTRFLTRL
FT                   LKKWTPEGRHFGDELLIKLVPDISQMLLKIVGDTQPTVRDAGFECLATLMKLVGEREVS
FT                   DVLDKLDNLKKKKVYEHYEKVEVAGGATKGAVTSAPARREKPSMPYTPNASRRQAPRTT
FT                   PTPDLSAQATSGSTLPLRKPLSTIPSKRGPSSPLKTGTRVETYQDGASSMKSRLTARSL
FT                   TTDSAPASKPQAAPHAGFEELQRQKQKWLKERQEFLATITDFQNKASHLSSENSSLRQQ
FT                   LDTVQSSLHESNIELRSKEMQITRLQDRISNLEQELEAKSTLPSSNYGVRSASSFEPPS
FT                   APLSLAPPGTPPTKRVFSSSSNGRASPSFDANSDRIADSRLPSVGSRLRSPSECSDDLP
FT                   HRVNSLQLRSAERAATTGNSFLNDESWKRAAEVTSQLKARIERMRAKTRGMGNS"
     MADSEDGDFT SLPLSERLDH KLWKARLHGY QELQALFQKA SVTSVPRELA QYWANPDLFA        60
     GYIVDSNVVA QEQAITALQN MLEYLCEFRD TPRSDEMRGR WLPLLAEKGL SSSRNSTKAK       120
     AQECVLILVS LDRSVEHSIE LLEPSLTNKL PRLVANCVEC ISNIVESFGL AQVSNMSGFL       180
     PVLLEPLPKL SSHADRNVRS QTMNLILQLY KWLGRDLLQE LLLEKLKPIQ QRDLDKTFGK       240
     YDGEIPPTSQ PRPFQWQKGL EVQNLEGSKD KDGDTLMGES FPDVKAHANP GLPQLDPFEL       300
     LPVSPVLEKF PLDFMERITS SKWKDRVEVL EEILNQVLIP TKKFEAKGQD YSDFLRAVAH       360
     VIEKDANVQA VTLAAQCVQQ LCQKLKANFT RSYGSIVLRS LLERSKEKKA SVNEAICEAL       420
     NNIADCCGVD ACLEDNLSFI NHKTPQVRTE STRFLTRLLK KWTPEGRHFG DELLIKLVPD       480
     ISQMLLKIVG DTQPTVRDAG FECLATLMKL VGEREVSDVL DKLDNLKKKK VYEHYEKVEV       540
     AGGATKGAVT SAPARREKPS MPYTPNASRR QAPRTTPTPD LSAQATSGST LPLRKPLSTI       600
     PSKRGPSSPL KTGTRVETYQ DGASSMKSRL TARSLTTDSA PASKPQAAPH AGFEELQRQK       660
     QKWLKERQEF LATITDFQNK ASHLSSENSS LRQQLDTVQS SLHESNIELR SKEMQITRLQ       720
     DRISNLEQEL EAKSTLPSSN YGVRSASSFE PPSAPLSLAP PGTPPTKRVF SSSSNGRASP       780
     SFDANSDRIA DSRLPSVGSR LRSPSECSDD LPHRVNSLQL RSAERAATTG NSFLNDESWK       840
     RAAEVTSQLK ARIERMRAKT RGMGNS                                            866
//

If you have problems or comments...

PBIL Back to PBIL home page