(data stored in SCRATCH zone)

EMBL: CU928166.PE420

CU928166.PE420       Location/Qualifiers
FT   CDS             841024..843090
FT                   /locus_tag="KLTH0B10076g"
FT                   /old_locus_tag="KLTH-ORF14492"
FT                   /product="KLTH0B10076p"
FT                   /note="some similarities with uniprot|P25502 Saccharomyces
FT                   cerevisiae YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10076g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21785"
FT                   /db_xref="GOA:C5DDC4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC4"
FT                   /protein_id="CAR21785.1"
FT                   /translation="MPRKKMMKACIKCKQRKKKCSGQLPCDYCVKIEQPGGCEYRTRTK
FT                   SKVVKVTERYISSLKNKIRALEAELAKASEGPDSEGCLEDGATSAEVNPLIEPEFRLTP
FT                   DLDSPKQESLTIGSVEHCVQASQHSKQFLGMSSCVQYLAKLKQSLVNSCGSSTEHFVAT
FT                   DGGWPPNDLDINRSFVENVATKELPDLRKAKELIEIAHEIIGADYMFLETGYFEDTAQH
FT                   LICKNPPPLQSEAIIEYTTELLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSEL
FT                   VKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIVENR
FT                   VFWLCFIYDRLLAVRFGFPLMIDERNINIPLLTEVDDNLTAVSLDIYHFVSQVRLAKIT
FT                   TQIITKIYTRNPYSFLHNCHAVLKQLKNWFESLPAELKFDYNDIKTATTRSTFNLHINY
FT                   NYSIIIATRPVLLYVFNSILTENRTKEKIYEARQLELISVLLESCVQAAEIQSRILAKL
FT                   YYDGKLANRSFLDCHYIFSATTVLILTGYCSMLSGESIAFSGDIEGLFDFIQHNLKILQ
FT                   GLSEYNLAAKNFNKQLTELIDMMSSDEVVKALATGRSQNDPTSVDFQQAVASPRPMSRI
FT                   LRKRGNNPPKDFEEIGYVDLSQLVNNMDAEFRSGSTTDLFLDEDFMNYASGSL"
     MPRKKMMKAC IKCKQRKKKC SGQLPCDYCV KIEQPGGCEY RTRTKSKVVK VTERYISSLK        60
     NKIRALEAEL AKASEGPDSE GCLEDGATSA EVNPLIEPEF RLTPDLDSPK QESLTIGSVE       120
     HCVQASQHSK QFLGMSSCVQ YLAKLKQSLV NSCGSSTEHF VATDGGWPPN DLDINRSFVE       180
     NVATKELPDL RKAKELIEIA HEIIGADYMF LETGYFEDTA QHLICKNPPP LQSEAIIEYT       240
     TELLRLVAHL ALGSLFDKEN AESRSLGLKY HRTTLLLYSE LVKTYDCAAS TSLILSLLYM       300
     AYFSLSLNKA TSAFVMTGSA IRTMFTLGLH KRTKTIVENR VFWLCFIYDR LLAVRFGFPL       360
     MIDERNINIP LLTEVDDNLT AVSLDIYHFV SQVRLAKITT QIITKIYTRN PYSFLHNCHA       420
     VLKQLKNWFE SLPAELKFDY NDIKTATTRS TFNLHINYNY SIIIATRPVL LYVFNSILTE       480
     NRTKEKIYEA RQLELISVLL ESCVQAAEIQ SRILAKLYYD GKLANRSFLD CHYIFSATTV       540
     LILTGYCSML SGESIAFSGD IEGLFDFIQH NLKILQGLSE YNLAAKNFNK QLTELIDMMS       600
     SDEVVKALAT GRSQNDPTSV DFQQAVASPR PMSRILRKRG NNPPKDFEEI GYVDLSQLVN       660
     NMDAEFRSGS TTDLFLDEDF MNYASGSL                                          688
//

If you have problems or comments...

PBIL Back to PBIL home page