(data stored in ACNUC8465 zone)

EMBL: CU928166.PE421

CU928166.PE421       Location/Qualifiers
FT   CDS             complement(843319..844122)
FT                   /locus_tag="KLTH0B10098g"
FT                   /old_locus_tag="KLTH-ORF14491"
FT                   /product="KLTH0B10098p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10098g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21786"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC5"
FT                   /protein_id="CAR21786.1"
FT                   /translation="MSNPESFRELCRKEIHTGPTSGVLPGYIQANLLILPKCVAESFED
FT                   LCTRNPVACPILSKTEGGPQFLRNHASLIKQGTFDIRTDFPRYNVYSRGKLVQQKNNCV
FT                   NEWSSDHVGFLIGCSFTFEHALEKAGLVPKNVLYNKNVSMFRTTKFLDSAGIFHQCPYV
FT                   VSMRPYKLTEVEIVREITRKFKKTHGEPLDWGYDGAKRLGIEDLQKPDYGDPIDIGEQE
FT                   IPMFWACGVTPQLAVTTVGDRIEGSVIGHTPGHMLILDATDVDWC"
     MSNPESFREL CRKEIHTGPT SGVLPGYIQA NLLILPKCVA ESFEDLCTRN PVACPILSKT        60
     EGGPQFLRNH ASLIKQGTFD IRTDFPRYNV YSRGKLVQQK NNCVNEWSSD HVGFLIGCSF       120
     TFEHALEKAG LVPKNVLYNK NVSMFRTTKF LDSAGIFHQC PYVVSMRPYK LTEVEIVREI       180
     TRKFKKTHGE PLDWGYDGAK RLGIEDLQKP DYGDPIDIGE QEIPMFWACG VTPQLAVTTV       240
     GDRIEGSVIG HTPGHMLILD ATDVDWC                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page