(data stored in ACNUC8465 zone)

EMBL: CU928166.PE423

CU928166.PE423       Location/Qualifiers
FT   CDS             complement(852039..852989)
FT                   /locus_tag="KLTH0B10164g"
FT                   /old_locus_tag="KLTH-ORF14483"
FT                   /product="KLTH0B10164p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10164g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21788"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC7"
FT                   /protein_id="CAR21788.1"
FT                   /translation="MMFAAFSPSKIAMYRFFVFGLSFLAIAASFPLYKRADLDVDILQF
FT                   ALTLERLENKFYKEALSMWSVDDFVDANFTEDFYTQLKYIAHDEEAHLLFLEQVIKAAG
FT                   AEPVQACTYNLPLDSPVSFVQSIAAFEGVGVSAYLGAASLISSKKYLTAAGSILSTEAI
FT                   HQAAARNAIGEIPMANPFATPLSANAIYSIASKFIKSCPANNTKLPFKAYPELLVTQGL
FT                   PTAMNSSITFASNGTLPNSTQIYVTFVSGLDVIPVVGSRNGSSIRATVPEDVSGQSYVF
FT                   LTTGNSSNLTDSNILYGPAIIEVTPSSPTFNVSIF"
     MMFAAFSPSK IAMYRFFVFG LSFLAIAASF PLYKRADLDV DILQFALTLE RLENKFYKEA        60
     LSMWSVDDFV DANFTEDFYT QLKYIAHDEE AHLLFLEQVI KAAGAEPVQA CTYNLPLDSP       120
     VSFVQSIAAF EGVGVSAYLG AASLISSKKY LTAAGSILST EAIHQAAARN AIGEIPMANP       180
     FATPLSANAI YSIASKFIKS CPANNTKLPF KAYPELLVTQ GLPTAMNSSI TFASNGTLPN       240
     STQIYVTFVS GLDVIPVVGS RNGSSIRATV PEDVSGQSYV FLTTGNSSNL TDSNILYGPA       300
     IIEVTPSSPT FNVSIF                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page