(data stored in ACNUC8465 zone)

EMBL: CU928166.PE425

CU928166.PE425       Location/Qualifiers
FT   CDS             861584..862198
FT                   /locus_tag="KLTH0B10230g"
FT                   /old_locus_tag="KLTH-ORF14472"
FT                   /product="KLTH0B10230p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10230g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21790"
FT                   /db_xref="GOA:C5DDC9"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC9"
FT                   /protein_id="CAR21790.1"
FT                   /translation="MKGERAEEHLIQTPHVDDQNLRLPRDTFPNRFLYEISRHRTFVIA
FT                   VSSELILYAFSIYRGLTSKDRDIGFLIALFMIVLGSTGIILTGIITICLLNDCGTDPSN
FT                   TLHFMKEIVAVGLQMEMREWDIIAARMNRVFYLNNSWATPYFFYDGEACHSFFKNYYLK
FT                   HYSRGEKTSGTNTYGLEEFQPFVDQAVEAYKKSETRMCSPF"
     MKGERAEEHL IQTPHVDDQN LRLPRDTFPN RFLYEISRHR TFVIAVSSEL ILYAFSIYRG        60
     LTSKDRDIGF LIALFMIVLG STGIILTGII TICLLNDCGT DPSNTLHFMK EIVAVGLQME       120
     MREWDIIAAR MNRVFYLNNS WATPYFFYDG EACHSFFKNY YLKHYSRGEK TSGTNTYGLE       180
     EFQPFVDQAV EAYKKSETRM CSPF                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page