(data stored in ACNUC8465 zone)

EMBL: CU928166.PE426

CU928166.PE426       Location/Qualifiers
FT   CDS             863070..863741
FT                   /locus_tag="KLTH0B10252g"
FT                   /old_locus_tag="KLTH-ORF14470"
FT                   /product="KLTH0B10252p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10252g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21791"
FT                   /db_xref="GOA:C5DDD0"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD0"
FT                   /protein_id="CAR21791.1"
FT                   /translation="MMREERVEEYSLHASQEDDQSLTLPRDIYPNKFLYQISRHRAPLF
FT                   ATSLELVLCTLLIRYFMKKNDSSARFEAVSSVVSFGLPLGLSLFSGMVHLVHNCGKAPV
FT                   NRVRFMEEIIAVEPGTETRKWDSIAARLNAIFYSNNSLATPHFFYDGNACYFYFRLHYV
FT                   RPLFEKKESSYAFREFPDEFKALIHQAMEAYKKGLDKDWQRLLNTGSSLGIRASTSEKM
FT                   T"
     MMREERVEEY SLHASQEDDQ SLTLPRDIYP NKFLYQISRH RAPLFATSLE LVLCTLLIRY        60
     FMKKNDSSAR FEAVSSVVSF GLPLGLSLFS GMVHLVHNCG KAPVNRVRFM EEIIAVEPGT       120
     ETRKWDSIAA RLNAIFYSNN SLATPHFFYD GNACYFYFRL HYVRPLFEKK ESSYAFREFP       180
     DEFKALIHQA MEAYKKGLDK DWQRLLNTGS SLGIRASTSE KMT                         223
//

If you have problems or comments...

PBIL Back to PBIL home page