(data stored in ACNUC8465 zone)

EMBL: CU928166.PE427

CU928166.PE427       Location/Qualifiers
FT   CDS             865279..865761
FT                   /locus_tag="KLTH0B10274g"
FT                   /old_locus_tag="KLTH-ORF14468"
FT                   /product="KLTH0B10274p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10274g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21792"
FT                   /db_xref="GOA:C5DDD1"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD1"
FT                   /protein_id="CAR21792.1"
FT                   /translation="MARKFISGDDLAAIRIFIVSLGMAGTAITGAIIEGRVESVILMPS
FT                   NKVQFMKEIAILGPGLEMKKGGVVAAKMNPVLHKSSLLATPYYFYDGESCYSCFRNEYL
FT                   HPYLRRKNTNDTQAYIVDEFKPFVDQVLKSYEESLNKDLQHMLEEEISVESQHIKL"
     MARKFISGDD LAAIRIFIVS LGMAGTAITG AIIEGRVESV ILMPSNKVQF MKEIAILGPG        60
     LEMKKGGVVA AKMNPVLHKS SLLATPYYFY DGESCYSCFR NEYLHPYLRR KNTNDTQAYI       120
     VDEFKPFVDQ VLKSYEESLN KDLQHMLEEE ISVESQHIKL                             160
//

If you have problems or comments...

PBIL Back to PBIL home page