(data stored in SCRATCH zone)

EMBL: CU928166.PE428

CU928166.PE428       Location/Qualifiers
FT   CDS             867082..867360
FT                   /locus_tag="KLTH0B10296g"
FT                   /old_locus_tag="KLTH-ORF14466"
FT                   /product="KLTH0B10296p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10296g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21793"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD2"
FT                   /protein_id="CAR21793.1"
FT                   /translation="MVKPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFFK
FT                   AKYLLPHLERKGANSTGEMPLYDLEPFYGQILDAYEERTKKEWQHIL"
     MVKPGIDMRK WDFIAAKMNA NLYQNNSLIS PYYYYNGEAC YCFFKAKYLL PHLERKGANS        60
     TGEMPLYDLE PFYGQILDAY EERTKKEWQH IL                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page