(data stored in SCRATCH zone)

EMBL: CU928166.PE430

CU928166.PE430       Location/Qualifiers
FT   CDS             874656..875879
FT                   /locus_tag="KLTH0B10340g"
FT                   /old_locus_tag="KLTH-ORF14454"
FT                   /product="KLTH0B10340p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10340g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21795"
FT                   /db_xref="GOA:C5DDD4"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD4"
FT                   /protein_id="CAR21795.1"
FT                   /translation="MSIVWVGAIRKNAQQDIMLKKLCLGLLALATTTLCESISRDVTTT
FT                   TVIAAVSSSSSSLTVATPGTPVSPKVLLIANEFEFGYLDAYNFTTQYTGVLFDQTFACT
FT                   EDGAICKLECGQELVSASQITALMMIPGVDLKKTYVIITGTGGVNPKYGTAGGAAISTF
FT                   GIQWEWGSMFLGDDLPANFSGQYFASYAQLSPDKYPVTVGSEVYKLNEALVDRFYATGS
FT                   KVTYEDVSETSQGLRATYEYDAAKQDPFLARCDTVSAQVYWHGNVAGENVEYYSNVITN
FT                   GQARPCNTNEDDQGRLLALFLGAVHHMVDFGRVSMIKAFSNFDRPPPQLSAYQSRFYVG
FT                   EGATEPGLRNAWKSIIVIVDDVLENWDSVFDAGIKPNTYMGDIKGTLGGVCDFNSTASA
FT                   AKGSVQGS"
     MSIVWVGAIR KNAQQDIMLK KLCLGLLALA TTTLCESISR DVTTTTVIAA VSSSSSSLTV        60
     ATPGTPVSPK VLLIANEFEF GYLDAYNFTT QYTGVLFDQT FACTEDGAIC KLECGQELVS       120
     ASQITALMMI PGVDLKKTYV IITGTGGVNP KYGTAGGAAI STFGIQWEWG SMFLGDDLPA       180
     NFSGQYFASY AQLSPDKYPV TVGSEVYKLN EALVDRFYAT GSKVTYEDVS ETSQGLRATY       240
     EYDAAKQDPF LARCDTVSAQ VYWHGNVAGE NVEYYSNVIT NGQARPCNTN EDDQGRLLAL       300
     FLGAVHHMVD FGRVSMIKAF SNFDRPPPQL SAYQSRFYVG EGATEPGLRN AWKSIIVIVD       360
     DVLENWDSVF DAGIKPNTYM GDIKGTLGGV CDFNSTASAA KGSVQGS                     407
//

If you have problems or comments...

PBIL Back to PBIL home page