(data stored in SCRATCH zone)

EMBL: CU928166.PE434

CU928166.PE434       Location/Qualifiers
FT   CDS             888176..889927
FT                   /locus_tag="KLTH0B10472g"
FT                   /old_locus_tag="KLTH-ORF14441"
FT                   /product="KLTH0B10472p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10472g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21799"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD8"
FT                   /protein_id="CAR21799.1"
FT                   /translation="MKIQSVCVLFLVLCLVEPSSLNQSRRKYASKSQTLFQTANTTTHL
FT                   SSQIESDGLLLINSRSNVSLGYATIDQLQDYLSNGSLSSQDLVRYYLQRFQQLNPHVKG
FT                   ILQLNPDALKIAKERDEERTQGLVRGPLHGIPFLVKDNYATKDKMETTCGSWSLLGSVV
FT                   PRDAFVVAKLRDAGAVLLGHTTLSEWADMRSSCYSEGYSARGGQARCPFDLSVSPGGSS
FT                   SGSAVAVAADMVTFSLGTETDGSIIDPAMKNGIVGFKPTVGLTSRAGVVPESEHQDSTG
FT                   PMARTVRDAVYAFQYMWGVDERDVYTLNQTGHVPQDGDYVKFLSDKESLKGARFGIPWQ
FT                   KLWTLAEENEISRLAEVIKMIESAGATIYNNTNFKNLDVVSSSGWDWNMGPANESEFTV
FT                   VKVDFFNNIESYLSELENSDMRSLKDIVEYNNRNYETEGGTENTHHAFQSGQDSFMESL
FT                   SWGGVQNETYWQAVEFVQKTSRGEGIDYALNYTDPETGENFNLDGLLVPSGLPITHQQA
FT                   AKAGYPMITLPVASKESNGRPFGLGIIQSAWEEPKLIKYGSAIEDLLNYQLKPWSNDNL
FT                   DKNISTT"
     MKIQSVCVLF LVLCLVEPSS LNQSRRKYAS KSQTLFQTAN TTTHLSSQIE SDGLLLINSR        60
     SNVSLGYATI DQLQDYLSNG SLSSQDLVRY YLQRFQQLNP HVKGILQLNP DALKIAKERD       120
     EERTQGLVRG PLHGIPFLVK DNYATKDKME TTCGSWSLLG SVVPRDAFVV AKLRDAGAVL       180
     LGHTTLSEWA DMRSSCYSEG YSARGGQARC PFDLSVSPGG SSSGSAVAVA ADMVTFSLGT       240
     ETDGSIIDPA MKNGIVGFKP TVGLTSRAGV VPESEHQDST GPMARTVRDA VYAFQYMWGV       300
     DERDVYTLNQ TGHVPQDGDY VKFLSDKESL KGARFGIPWQ KLWTLAEENE ISRLAEVIKM       360
     IESAGATIYN NTNFKNLDVV SSSGWDWNMG PANESEFTVV KVDFFNNIES YLSELENSDM       420
     RSLKDIVEYN NRNYETEGGT ENTHHAFQSG QDSFMESLSW GGVQNETYWQ AVEFVQKTSR       480
     GEGIDYALNY TDPETGENFN LDGLLVPSGL PITHQQAAKA GYPMITLPVA SKESNGRPFG       540
     LGIIQSAWEE PKLIKYGSAI EDLLNYQLKP WSNDNLDKNI STT                         583
//

If you have problems or comments...

PBIL Back to PBIL home page