(data stored in ACNUC8465 zone)

EMBL: CU928166.PE435

CU928166.PE435       Location/Qualifiers
FT   CDS             complement(890670..892271)
FT                   /locus_tag="KLTH0B10494g"
FT                   /old_locus_tag="KLTH-ORF14438"
FT                   /product="KLTH0B10494p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B10494g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21800"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD9"
FT                   /protein_id="CAR21800.1"
FT                   /translation="MKLKCFCTISLAASFVAADWQFKSRPDLSPPILNIAIPANQNTSP
FT                   GYLFAAPFSGYADNKNHGPRQAAPYIFTDKGELVWSGFSYFSIWATNFQKGRLNGEDIL
FT                   FSFEGSHNPDYGHGHGHVTILDSHYQTIKELRAGRHKIIDKHEFHIIDEKTGLVQIYQP
FT                   VPRDLTLYAKSEEQQWIVDAIFQEIDIESGEVLFEWRSLDWISPDESILPINEGQAGSG
FT                   FNSSDAWDYFHINSVDKNEEGDYLLSARDAAALYKINGTSGEVIWKLGGLPELSSDFKI
FT                   DFQFSFQHHARFISRNGSKEVISFYDNSAHGTENKDGKTVSYAETSSGKVIEVDNKEFT
FT                   AHLLREFLPPDGLLSKSQGSTQVLSDGHVIVNWGSKGAVTEYNSKDEAVFHAYFDSDLL
FT                   GENVENYRAFKFNWIGEPDEDISLYSEISADGEASIYVSWNGDTKTQKWRFFELDEEGE
FT                   KQIIGATTRKGFETAFKTNKIKLSNKVLVEALGERGEVLGVSDPTLSQKEIIPAGGKKV
FT                   STKNSFSNYFEWRMWQ"
     MKLKCFCTIS LAASFVAADW QFKSRPDLSP PILNIAIPAN QNTSPGYLFA APFSGYADNK        60
     NHGPRQAAPY IFTDKGELVW SGFSYFSIWA TNFQKGRLNG EDILFSFEGS HNPDYGHGHG       120
     HVTILDSHYQ TIKELRAGRH KIIDKHEFHI IDEKTGLVQI YQPVPRDLTL YAKSEEQQWI       180
     VDAIFQEIDI ESGEVLFEWR SLDWISPDES ILPINEGQAG SGFNSSDAWD YFHINSVDKN       240
     EEGDYLLSAR DAAALYKING TSGEVIWKLG GLPELSSDFK IDFQFSFQHH ARFISRNGSK       300
     EVISFYDNSA HGTENKDGKT VSYAETSSGK VIEVDNKEFT AHLLREFLPP DGLLSKSQGS       360
     TQVLSDGHVI VNWGSKGAVT EYNSKDEAVF HAYFDSDLLG ENVENYRAFK FNWIGEPDED       420
     ISLYSEISAD GEASIYVSWN GDTKTQKWRF FELDEEGEKQ IIGATTRKGF ETAFKTNKIK       480
     LSNKVLVEAL GERGEVLGVS DPTLSQKEII PAGGKKVSTK NSFSNYFEWR MWQ              533
//

If you have problems or comments...

PBIL Back to PBIL home page