(data stored in ACNUC8465 zone)

EMBL: CU928166.PE50

CU928166.PE50        Location/Qualifiers
FT   CDS             complement(118238..119137)
FT                   /locus_tag="KLTH0B01452g"
FT                   /old_locus_tag="KLTH-ORF15821"
FT                   /product="KLTH0B01452p"
FT                   /note="similar to uniprot|P42938 Saccharomyces cerevisiae
FT                   YGR205W Protein that binds ATP crystal structure resembles
FT                   that of E.coli pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01452g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA4"
FT                   /protein_id="CAR21415.1"
FT                   /translation="MTKRTLVDESTHFVLTHYDSKPEGKEGDDRSPFLVLISGPQGSGK
FT                   TTSTHAIKQKLHELRPELKCLCVSIDDFYLTHADQQKVSNNNSGNGLQQGRGLPGTHDM
FT                   RLLDSFMQRLHENKGSVHVPVYDKSLFGGEGDRSASADEVALPVDVVIVEGWFLGFEAV
FT                   GEKTLEQMRSEVSSPRGKLLRTHELQHLLQVDSGLGAYARALWNNPTFRSVGVVIAADV
FT                   ANIYRWRQQQEAQMIAKYGSGMNEEQVKAFVLRYMPCYELYYRSLMEHGSLGTEAALVV
FT                   HIDADRTVTGVEEKTRAA"
     MTKRTLVDES THFVLTHYDS KPEGKEGDDR SPFLVLISGP QGSGKTTSTH AIKQKLHELR        60
     PELKCLCVSI DDFYLTHADQ QKVSNNNSGN GLQQGRGLPG THDMRLLDSF MQRLHENKGS       120
     VHVPVYDKSL FGGEGDRSAS ADEVALPVDV VIVEGWFLGF EAVGEKTLEQ MRSEVSSPRG       180
     KLLRTHELQH LLQVDSGLGA YARALWNNPT FRSVGVVIAA DVANIYRWRQ QQEAQMIAKY       240
     GSGMNEEQVK AFVLRYMPCY ELYYRSLMEH GSLGTEAALV VHIDADRTVT GVEEKTRAA        299
//

If you have problems or comments...

PBIL Back to PBIL home page