(data stored in SCRATCH zone)

EMBL: CU928166.PE55

CU928166.PE55        Location/Qualifiers
FT   CDS             complement(125475..125924)
FT                   /locus_tag="KLTH0B01562g"
FT                   /old_locus_tag="KLTH-ORF15798"
FT                   /product="KLTH0B01562p"
FT                   /note="similar to uniprot|P42937 YGR203W Saccharomyces
FT                   cerevisiae Probable protein tyrosine phosphatase of the
FT                   CDC25-like phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01562g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21420"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCA9"
FT                   /protein_id="CAR21420.1"
FT                   /translation="MNSRSVAAIRYVDAAELFQWIKRGTTGAGEPFQVIDVRGSDYIGG
FT                   HIVNGWNYPYRELRDGGARMEELMQRLRSAAGAAGAQPINCVFHCAQSQQRGPSAAMKF
FT                   LRSVADEDLARMRVCVLRGGFNHWQAEYGEDASVTEAYVPDLWRM"
     MNSRSVAAIR YVDAAELFQW IKRGTTGAGE PFQVIDVRGS DYIGGHIVNG WNYPYRELRD        60
     GGARMEELMQ RLRSAAGAAG AQPINCVFHC AQSQQRGPSA AMKFLRSVAD EDLARMRVCV       120
     LRGGFNHWQA EYGEDASVTE AYVPDLWRM                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page