(data stored in ACNUC8465 zone)

EMBL: CU928166.PE58

CU928166.PE58        Location/Qualifiers
FT   CDS             129632..132004
FT                   /locus_tag="KLTH0B01628g"
FT                   /product="KLTH0B01628p"
FT                   /note="similar to uniprot|P42935 Saccharomyces cerevisiae
FT                   YGR200C ELP2 Elongator protein part of the six- subunit RNA
FT                   polymerase II Elongator histone acetyltransferase complex
FT                   target of Kluyveromyces lactis zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01628g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21423"
FT                   /db_xref="GOA:C5DCB2"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR037289"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB2"
FT                   /protein_id="CAR21423.1"
FT                   /translation="MSGMAKAEAIFIGGNRQTQASDYNPKHGILAYGAGKTIAFWKPLD
FT                   PAHRGVYATLKGHDAEVTCVRFVPGTEFMITASEDSQVRLWAFDGEDNSAMACIQSTDH
FT                   HKHTITSLSVLSNLLTVGCADGSVSVWQINERQISLVHSFVLKAGVFPLCMALKSVEDS
FT                   KVLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMDFYEEGPGNMLLATG
FT                   SQDRYIRLWRIRTNDLIDNSDEDDSKLKLLSNKQSKFYIDGSLRVAINFEALIIGHDDW
FT                   VSCLKWHSDKLQLLASTADTAVMVWEPDAESGIWVCASRLGELSSKGASTATGSSGGFW
FT                   SCNWFTQEKADYILTNGKTGSWRMWKSDDISGWEQQLAITGPTKPTTDVAWSPNGLYLL
FT                   GTSLDQTTRLFARCKLDGEQDKISGSWFEFSRPQIHGYDMICVEPISNTRFISGGDEKI
FT                   MRSFDEPKGVAQILQKFAGVPFENEKYMPESASLPALGLSSKATADVDEDEDEDPDARE
FT                   TNETKNISFDIVASLHSPPVEDQLQRHTLWPEIEKLYGHGYEISCLDVSPDAKIIASAC
FT                   RSNNLQHAVIRFFDSNTWLHLEPAPQFHNLTITRLRFSKDNTQLLSVSRDRQWAVWKRD
FT                   LETNQFTLAYKNEKAHTRIIWDCEWAPLSFGSVFLTASRDKSIKLWRFSEEEQDYLQEA
FT                   SIKLGISVTAISVHEKLFDNKLIIAAGLENGSLQVYTYENEFQKVLEIEDRYTPADRIS
FT                   RLRWSSNGNELFLAAASADTSFRIYSVKSESIKNSPN"
     MSGMAKAEAI FIGGNRQTQA SDYNPKHGIL AYGAGKTIAF WKPLDPAHRG VYATLKGHDA        60
     EVTCVRFVPG TEFMITASED SQVRLWAFDG EDNSAMACIQ STDHHKHTIT SLSVLSNLLT       120
     VGCADGSVSV WQINERQISL VHSFVLKAGV FPLCMALKSV EDSKVLLAVG GTNSNVFIYS       180
     FTREAAALEN FQLAATLEGH EDWIKAMDFY EEGPGNMLLA TGSQDRYIRL WRIRTNDLID       240
     NSDEDDSKLK LLSNKQSKFY IDGSLRVAIN FEALIIGHDD WVSCLKWHSD KLQLLASTAD       300
     TAVMVWEPDA ESGIWVCASR LGELSSKGAS TATGSSGGFW SCNWFTQEKA DYILTNGKTG       360
     SWRMWKSDDI SGWEQQLAIT GPTKPTTDVA WSPNGLYLLG TSLDQTTRLF ARCKLDGEQD       420
     KISGSWFEFS RPQIHGYDMI CVEPISNTRF ISGGDEKIMR SFDEPKGVAQ ILQKFAGVPF       480
     ENEKYMPESA SLPALGLSSK ATADVDEDED EDPDARETNE TKNISFDIVA SLHSPPVEDQ       540
     LQRHTLWPEI EKLYGHGYEI SCLDVSPDAK IIASACRSNN LQHAVIRFFD SNTWLHLEPA       600
     PQFHNLTITR LRFSKDNTQL LSVSRDRQWA VWKRDLETNQ FTLAYKNEKA HTRIIWDCEW       660
     APLSFGSVFL TASRDKSIKL WRFSEEEQDY LQEASIKLGI SVTAISVHEK LFDNKLIIAA       720
     GLENGSLQVY TYENEFQKVL EIEDRYTPAD RISRLRWSSN GNELFLAAAS ADTSFRIYSV       780
     KSESIKNSPN                                                              790
//

If you have problems or comments...

PBIL Back to PBIL home page