(data stored in ACNUC8465 zone)

EMBL: CU928166.PE60

CU928166.PE60        Location/Qualifiers
FT   CDS             complement(134593..136791)
FT                   /locus_tag="KLTH0B01672g"
FT                   /old_locus_tag="KLTH-ORF15782"
FT                   /product="KLTH0B01672p"
FT                   /note="similar to uniprot|P46951 Saccharomyces cerevisiae
FT                   YGR198W Essential protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cytoplasm in a punctate pattern"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01672g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21425"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB4"
FT                   /protein_id="CAR21425.1"
FT                   /translation="MQEDYEQVEAALGSRLLGASEFRTKNKRLNQVLSLQYRVHYHVHQ
FT                   KGIIKEAACKVLLEECNRFERDSSDALVEKVWLNLAGILNYHLSHPQTADKCLAESAKI
FT                   SAAQGAFGTFLSVENLYYSGLLRGDKSRDFYVKHLPEVVTSLPKESNVLTYHYLDRIIS
FT                   RLSMNWSQAISAFPRTVISSFIAIMSEPDGHDQELLALGKTILASAKFPNAEEANNASL
FT                   EQFHLVLQHYLRSTKSELSPDWHSFVVESMSRTFQSMIVTKTAMIYFGRENQLRESILN
FT                   FNVFLNYNRSYRDLNNGEWFDVLAIIDAYEHIVSRSEGRDIPKIFALKDVMKRFEGLLC
FT                   SFYEDSALPLVKVERSIEWASEGTRVFVPERASSLLARSWNALYEYSREDLDKLLNDNH
FT                   TYYLANALAARPDNSKIAFNYAFTLAQKREITHAVKFLKSNILEREPENYKAWHLLALC
FT                   ESIKEDKNVSFKIVCSVLQALENAVHEDPQAPARDRWQLIHLKLTQLAIIQEMFGVNDA
FT                   LELLPELFELFNFAFPENGKNGDLGSAYNKTKDYLHQSVWLFAVKLYLTQGLIVDAREA
FT                   LAESRNVTKNFQNLNNDLADGYLSLDVDGKKALRSFEKVLFYDALNIDAIVGFAKCLVP
FT                   TSQENSSHQLQPQTPSAAGLDAFTGEKDRSAAYARLKMVLEEVVERSIEGCHAPEVWWY
FT                   LSRVYENYDDTERLETSLWNCVKYQELQPIRDFKNCNF"
     MQEDYEQVEA ALGSRLLGAS EFRTKNKRLN QVLSLQYRVH YHVHQKGIIK EAACKVLLEE        60
     CNRFERDSSD ALVEKVWLNL AGILNYHLSH PQTADKCLAE SAKISAAQGA FGTFLSVENL       120
     YYSGLLRGDK SRDFYVKHLP EVVTSLPKES NVLTYHYLDR IISRLSMNWS QAISAFPRTV       180
     ISSFIAIMSE PDGHDQELLA LGKTILASAK FPNAEEANNA SLEQFHLVLQ HYLRSTKSEL       240
     SPDWHSFVVE SMSRTFQSMI VTKTAMIYFG RENQLRESIL NFNVFLNYNR SYRDLNNGEW       300
     FDVLAIIDAY EHIVSRSEGR DIPKIFALKD VMKRFEGLLC SFYEDSALPL VKVERSIEWA       360
     SEGTRVFVPE RASSLLARSW NALYEYSRED LDKLLNDNHT YYLANALAAR PDNSKIAFNY       420
     AFTLAQKREI THAVKFLKSN ILEREPENYK AWHLLALCES IKEDKNVSFK IVCSVLQALE       480
     NAVHEDPQAP ARDRWQLIHL KLTQLAIIQE MFGVNDALEL LPELFELFNF AFPENGKNGD       540
     LGSAYNKTKD YLHQSVWLFA VKLYLTQGLI VDAREALAES RNVTKNFQNL NNDLADGYLS       600
     LDVDGKKALR SFEKVLFYDA LNIDAIVGFA KCLVPTSQEN SSHQLQPQTP SAAGLDAFTG       660
     EKDRSAAYAR LKMVLEEVVE RSIEGCHAPE VWWYLSRVYE NYDDTERLET SLWNCVKYQE       720
     LQPIRDFKNC NF                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page