(data stored in ACNUC8465 zone)

EMBL: CU928166.PE62

CU928166.PE62        Location/Qualifiers
FT   CDS             137755..140211
FT                   /locus_tag="KLTH0B01716g"
FT                   /old_locus_tag="KLTH-ORF15778"
FT                   /product="KLTH0B01716p"
FT                   /note="weakly similar to uniprot|P46949 Saccharomyces
FT                   cerevisiae YGR196C FYV8 Protein of unknown function
FT                   required for survival upon exposure to K1 killer toxin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01716g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21427"
FT                   /db_xref="InterPro:IPR026248"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB6"
FT                   /protein_id="CAR21427.1"
FT                   /translation="MSDNVERRKSQRWVSVGKGSYDGKEWDSSDEDGSYEAWEDDNGET
FT                   AQSPKRSGTVTKLPPLPKLQYGRDVDSAPEGSNGSSPKLESTSSNLDQLMSQISHEMTP
FT                   RSESRERFSPNDGTPRPPRQFGDEGDEHSSAFSYSDSEEELQVSKTGYFSNMVGATQSA
FT                   GRSGSYSDDEVYVTPDPSSLSRATAEPEAARMDTRGSDSASSAAHASKSELERYNASPD
FT                   DRESMSASTTEVSKSSSPKENSASLSGGQPASVKSDNGSSETDHLTGSVLSSADEVHTG
FT                   SKDVQSGLESVQGSQPSGSAVEESKETISKGTLAHQGDDTAPQQEPHESHGTPIKDARN
FT                   NSSDEYGDNESFFNHYGNNSSQSSPANNPDNSPKKHDSSPLKLRQSSKTQLGYENVKSQ
FT                   AQDENSSDNASSTSEPGSFKFKDRVRESILESSDEDIGDDESVLRVPTSGYYAKMLKDS
FT                   SQAERGDDQSTETEGSSIVSSETDTGSITKSINGSNQDGATTPEAISPRKHNEEDQTTD
FT                   TEPLEEQEGSKNLQSRQSINLGKWQPDTDATRAAFLGEARPEVPEDFVIDQDGNMVDVN
FT                   PSSMRNPRVVSTYSEAESAWNAFPSAGNAEGDLDTIYDTKTIYDNQTIYNVPGIATNNS
FT                   SLPPLPNNISALESSDSAAVTDSDSILRHLSGEKKPHFSNLKENFSVHTPNSEEIAQVR
FT                   GREAPSVNLDSLISAKGKTHAMKISDLRNHSEQLNAYDTGLHTWINYALKNSSSDKDYI
FT                   FQDYKVNKHVRDAYAQADELSKKMTVSNTVANVNQNVSHLKRKVFSHTMKEKSKGLFSS
FT                   IGKKKA"
     MSDNVERRKS QRWVSVGKGS YDGKEWDSSD EDGSYEAWED DNGETAQSPK RSGTVTKLPP        60
     LPKLQYGRDV DSAPEGSNGS SPKLESTSSN LDQLMSQISH EMTPRSESRE RFSPNDGTPR       120
     PPRQFGDEGD EHSSAFSYSD SEEELQVSKT GYFSNMVGAT QSAGRSGSYS DDEVYVTPDP       180
     SSLSRATAEP EAARMDTRGS DSASSAAHAS KSELERYNAS PDDRESMSAS TTEVSKSSSP       240
     KENSASLSGG QPASVKSDNG SSETDHLTGS VLSSADEVHT GSKDVQSGLE SVQGSQPSGS       300
     AVEESKETIS KGTLAHQGDD TAPQQEPHES HGTPIKDARN NSSDEYGDNE SFFNHYGNNS       360
     SQSSPANNPD NSPKKHDSSP LKLRQSSKTQ LGYENVKSQA QDENSSDNAS STSEPGSFKF       420
     KDRVRESILE SSDEDIGDDE SVLRVPTSGY YAKMLKDSSQ AERGDDQSTE TEGSSIVSSE       480
     TDTGSITKSI NGSNQDGATT PEAISPRKHN EEDQTTDTEP LEEQEGSKNL QSRQSINLGK       540
     WQPDTDATRA AFLGEARPEV PEDFVIDQDG NMVDVNPSSM RNPRVVSTYS EAESAWNAFP       600
     SAGNAEGDLD TIYDTKTIYD NQTIYNVPGI ATNNSSLPPL PNNISALESS DSAAVTDSDS       660
     ILRHLSGEKK PHFSNLKENF SVHTPNSEEI AQVRGREAPS VNLDSLISAK GKTHAMKISD       720
     LRNHSEQLNA YDTGLHTWIN YALKNSSSDK DYIFQDYKVN KHVRDAYAQA DELSKKMTVS       780
     NTVANVNQNV SHLKRKVFSH TMKEKSKGLF SSIGKKKA                               818
//

If you have problems or comments...

PBIL Back to PBIL home page