(data stored in ACNUC8465 zone)

EMBL: CU928166.PE65

CU928166.PE65        Location/Qualifiers
FT   CDS             143331..143672
FT                   /locus_tag="KLTH0B01782g"
FT                   /old_locus_tag="KLTH-ORF15770"
FT                   /product="KLTH0B01782p"
FT                   /note="some similarities with uniprot|P47087 Saccharomyces
FT                   cerevisiae YJR012C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01782g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21430"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCB9"
FT                   /protein_id="CAR21430.1"
FT                   /translation="MSGPLTYEELVDHIVNEKPIPNILSVPNVTLDPSLVTKSNMKPRP
FT                   KPWERNNAATSELAGEPPHQQTAVAEGPEICTRSRSSESLSKYYAIEAEFEQQLQSFLG
FT                   GNEESEKLQ"
     MSGPLTYEEL VDHIVNEKPI PNILSVPNVT LDPSLVTKSN MKPRPKPWER NNAATSELAG        60
     EPPHQQTAVA EGPEICTRSR SSESLSKYYA IEAEFEQQLQ SFLGGNEESE KLQ              113
//

If you have problems or comments...

PBIL Back to PBIL home page