(data stored in ACNUC8465 zone)

EMBL: CU928166.PE69

CU928166.PE69        Location/Qualifiers
FT   CDS             146628..148373
FT                   /locus_tag="KLTH0B01870g"
FT                   /old_locus_tag="KLTH-ORF15764"
FT                   /product="KLTH0B01870p"
FT                   /note="similar to uniprot|P42826 Saccharomyces cerevisiae
FT                   YGR194C XKS1 third enzyme in the xylose pathway;
FT                   Xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01870g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21434"
FT                   /db_xref="GOA:C5DCC3"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC3"
FT                   /protein_id="CAR21434.1"
FT                   /translation="MTADKVGAFYLGFDLSTQQLKCLVIDQNLALVHSETIGFDKDLSH
FT                   YKTTKGVYLHEDGTVECPVAMWLEAVDLVFERMSKHKHIDLSLVRAMSGSCQQHGSVYW
FT                   AESGPGLLPKLDSKQSLKQQLYPEAFSRNVAPNWQDHSTGEECREFEESCGGAAQLAQV
FT                   TGSRAHHRFTGPQIMKIAKKEPEVYRATSKVSLVSSFLASILAGEFTPLEEADACGMNL
FT                   YNIDKRDYDDKLLRNVDDDTETLRSKLGGPPINCDKPAPVGTLSPYFVEKYGLNPECQI
FT                   FPFTGDNLATICSLPLQPNDVLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIPRHYMGM
FT                   ICYCNGALARERIRDQLSETHDWEPFNAAVKSTTLNTDNEIACYFPLGEIVPNVPSSYR
FT                   RATFAKSPDSQEVKLELKDAFADIAHDAKNIVESQALSCRVRISPLLSKDCADPSVDLG
FT                   DSMVHFDCDDFPLSEYKKRPRRAFFVGGASKNDAIVERFAQVLGATDGNFRLETPNSCA
FT                   LGGCYRAMWSHLYYGGLTKAPFDNFLNEQFRWDTDVQSLSLTKDKEWQYFNNKIQALSE
FT                   LEKTL"
     MTADKVGAFY LGFDLSTQQL KCLVIDQNLA LVHSETIGFD KDLSHYKTTK GVYLHEDGTV        60
     ECPVAMWLEA VDLVFERMSK HKHIDLSLVR AMSGSCQQHG SVYWAESGPG LLPKLDSKQS       120
     LKQQLYPEAF SRNVAPNWQD HSTGEECREF EESCGGAAQL AQVTGSRAHH RFTGPQIMKI       180
     AKKEPEVYRA TSKVSLVSSF LASILAGEFT PLEEADACGM NLYNIDKRDY DDKLLRNVDD       240
     DTETLRSKLG GPPINCDKPA PVGTLSPYFV EKYGLNPECQ IFPFTGDNLA TICSLPLQPN       300
     DVLVSLGTST TILLVTDQYH PSPNYHLFIH PTIPRHYMGM ICYCNGALAR ERIRDQLSET       360
     HDWEPFNAAV KSTTLNTDNE IACYFPLGEI VPNVPSSYRR ATFAKSPDSQ EVKLELKDAF       420
     ADIAHDAKNI VESQALSCRV RISPLLSKDC ADPSVDLGDS MVHFDCDDFP LSEYKKRPRR       480
     AFFVGGASKN DAIVERFAQV LGATDGNFRL ETPNSCALGG CYRAMWSHLY YGGLTKAPFD       540
     NFLNEQFRWD TDVQSLSLTK DKEWQYFNNK IQALSELEKT L                           581
//

If you have problems or comments...

PBIL Back to PBIL home page