(data stored in ACNUC8465 zone)

EMBL: CU928166.PE70

CU928166.PE70        Location/Qualifiers
FT   CDS             148776..150023
FT                   /locus_tag="KLTH0B01892g"
FT                   /old_locus_tag="KLTH-ORF15759"
FT                   /product="KLTH0B01892p"
FT                   /note="similar to uniprot|P16451 Saccharomyces cerevisiae
FT                   YGR193C PDX1 Dihydrolipoamide dehydrogenase (E3)-binding
FT                   protein (E3BP) of the mitochondrial pyruvate dehydrogenase
FT                   (PDH) complex plays a structural role in the complex by
FT                   binding and positioning E3 to the dihydrolipoamide
FT                   acetyltransferase (E2) core"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01892g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21435"
FT                   /db_xref="GOA:C5DCC4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC4"
FT                   /protein_id="CAR21435.1"
FT                   /translation="MIARGLLRGNAGRLACLRALHRSSALSKAQTFAMPAMSPTMEKGG
FT                   IVEWKFKVGDPFSAGDVLLEVETDKAQIDVEAQDDGKLAKIVVDNGAKDINVGEVIAYL
FT                   AEPEDDLATLELPQPEKSTGKSKAETKSAAKPSATAKTSPASISQENKPEPKKNAPSKS
FT                   SSDSKSSTGVAVKANPSQTLLPSVQMLLHVNNISAEDALNNIPASGPNGRILKGDVLSY
FT                   LGKVSQESVTKLAEYIEKGSALDLTNIELKEPEPAPKAKEEVAKKEPVVLSEQLHLKVA
FT                   SGVTYEQLARSLESYVKEAKYLAHEQPTTNPYSEHFDAVFEELITPEPRAPRFEVSYDL
FT                   ISLGSSGISAKQQDDIFDLLAGTKPSPAASEVETAQPNEFLVSVRVQVSDKFTDAPTKA
FT                   ERFVQYLRDLESSAEL"
     MIARGLLRGN AGRLACLRAL HRSSALSKAQ TFAMPAMSPT MEKGGIVEWK FKVGDPFSAG        60
     DVLLEVETDK AQIDVEAQDD GKLAKIVVDN GAKDINVGEV IAYLAEPEDD LATLELPQPE       120
     KSTGKSKAET KSAAKPSATA KTSPASISQE NKPEPKKNAP SKSSSDSKSS TGVAVKANPS       180
     QTLLPSVQML LHVNNISAED ALNNIPASGP NGRILKGDVL SYLGKVSQES VTKLAEYIEK       240
     GSALDLTNIE LKEPEPAPKA KEEVAKKEPV VLSEQLHLKV ASGVTYEQLA RSLESYVKEA       300
     KYLAHEQPTT NPYSEHFDAV FEELITPEPR APRFEVSYDL ISLGSSGISA KQQDDIFDLL       360
     AGTKPSPAAS EVETAQPNEF LVSVRVQVSD KFTDAPTKAE RFVQYLRDLE SSAEL            415
//

If you have problems or comments...

PBIL Back to PBIL home page