(data stored in ACNUC8465 zone)

EMBL: CU928166.PE75

CU928166.PE75        Location/Qualifiers
FT   CDS             complement(157328..158236)
FT                   /locus_tag="KLTH0B02002g"
FT                   /old_locus_tag="KLTH-ORF15736"
FT                   /product="KLTH0B02002p"
FT                   /note="highly similar to uniprot|P20459 Saccharomyces
FT                   cerevisiae YJR007W SUI2 Alpha subunit of the translation
FT                   initiation factor eIF2 involved in the identification of
FT                   the start codon phosphorylation of Ser51 is required for
FT                   regulation of translation by inhibiting the exchange of GDP
FT                   for GTP"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02002g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21440"
FT                   /db_xref="GOA:C5DCC9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCC9"
FT                   /protein_id="CAR21440.1"
FT                   /translation="MSTSNCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEGM
FT                   VLLSELSRRRIRSIQKLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSSEDIIKCEERYQK
FT                   SKAVHSILRHCAEKFSFPLEDLYKSIAWPLSRKYGHAYDAFKLSIVDETVFEGIEPPSK
FT                   EIFEELRLYISRRLTPQAVKIRADIEVSCFSYEGIDAIKAALKAAEEMSTEQMQIKAKL
FT                   VAAPLYVLTTQALEKQHGIELLEKAIEKITKVITSHDGFCNITMAPKAVTATEDAELQA
FT                   LLENKALENGSDSEEEDSDYE"
     MSTSNCRFYE NKYPEVDDVV MVNVQQIAEM GAYVKLLEYD NIEGMVLLSE LSRRRIRSIQ        60
     KLIRVGRNEV VVVLRVDKEK GYIDLSKRRV SSEDIIKCEE RYQKSKAVHS ILRHCAEKFS       120
     FPLEDLYKSI AWPLSRKYGH AYDAFKLSIV DETVFEGIEP PSKEIFEELR LYISRRLTPQ       180
     AVKIRADIEV SCFSYEGIDA IKAALKAAEE MSTEQMQIKA KLVAAPLYVL TTQALEKQHG       240
     IELLEKAIEK ITKVITSHDG FCNITMAPKA VTATEDAELQ ALLENKALEN GSDSEEEDSD       300
     YE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page