(data stored in SCRATCH zone)

EMBL: CU928166.PE79

CU928166.PE79        Location/Qualifiers
FT   CDS             168159..168626
FT                   /locus_tag="KLTH0B02134g"
FT                   /old_locus_tag="KLTH-ORF15715"
FT                   /product="KLTH0B02134p"
FT                   /note="similar to uniprot|P47076 Saccharomyces cerevisiae
FT                   YJL011C RPC17 RNA polymerase III subunit C17 physically
FT                   interacts with C31 C11 and TFIIIB70 may be involved in the
FT                   recruitment of pol III by the preinitiation complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02134g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21444"
FT                   /db_xref="GOA:C5DCD3"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="InterPro:IPR038846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD3"
FT                   /protein_id="CAR21444.1"
FT                   /translation="MKIESVRDAFLSDYEVLQFLSQLERRHDWGLNQDDELAAGNNRKR
FT                   KRRPYNHPELQAITRDTIRYLSEAKGAADAEESEAGAGDTKSPLTKLNDKKFAELMTQL
FT                   NQFSLFKAEKLQIVNQLPTNLVHLYAIVEECDSRFSEEQSGQILEIVRNAC"
     MKIESVRDAF LSDYEVLQFL SQLERRHDWG LNQDDELAAG NNRKRKRRPY NHPELQAITR        60
     DTIRYLSEAK GAADAEESEA GAGDTKSPLT KLNDKKFAEL MTQLNQFSLF KAEKLQIVNQ       120
     LPTNLVHLYA IVEECDSRFS EEQSGQILEI VRNAC                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page