(data stored in ACNUC8465 zone)

EMBL: CU928166.PE81

CU928166.PE81        Location/Qualifiers
FT   CDS             171582..174551
FT                   /locus_tag="KLTH0B02178g"
FT                   /old_locus_tag="KLTH-ORF15707"
FT                   /product="KLTH0B02178p"
FT                   /note="similar to uniprot|P41695 Saccharomyces cerevisiae
FT                   YGR188C BUB1 Protein kinase that forms a complex with Mad1p
FT                   and Bub3p that is crucial in the checkpoint mechanism
FT                   required to prevent cell cycle progression into anaphase in
FT                   the presence of spindle damage associates with centromere
FT                   DNA via Skp1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02178g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21446"
FT                   /db_xref="GOA:C5DCD5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR012572"
FT                   /db_xref="InterPro:IPR013212"
FT                   /db_xref="InterPro:IPR015661"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD5"
FT                   /protein_id="CAR21446.1"
FT                   /translation="MSIGKAPVTNFDVIEVEKENIVPLRSGRSAAALSRSLKVRSDAGA
FT                   GTKVSEIRLEFEKRILHELDELDDPLELYLDYINWINNAYPQGGQSKQSGMLEVLERCL
FT                   MYFKDFDTYKNDPRYLKLWLWYLELFAGSESEKQSLFVFMMRKQIGSKLSLFYEELAAF
FT                   LEKQQDLPQAKDVLARGIENNARPLGRLRRTSQRFDERMRDMSVDVPSVPHGGSILDGE
FT                   LPSIVLGRARGQIEEASLKSKPSHSASAKHEIFKDVAGTDQFDDLKKEGWDHLDGRAQR
FT                   NKENEASKQLLAPGVNLGTLKQEGSTKISVNRVPIFKDSIGRSGPIYKILEIPGRKPEK
FT                   IDCNFDLVYPTKNQEYCFEELLAMSRGIYHKRPKAKRVLEIETIDISDNHSRERPSKQQ
FT                   KKALKEISPPPEAYRPSAQESQISNENDNLQDFKAVERTSILPLNDEPTLHYGTQKKSA
FT                   PSSPTVTFFSKDAIEEVYSMFNQNFSEPNRHLDNDDTTSKFAAFENFTQEFTRKTIDDL
FT                   TEVKQKIQSEQVNETPQKNENVPHGIEAPTEVSKETTTPSYKSKLQEYMTPIQERSESS
FT                   FKLASNSNEEYDNEVTKNNTITNTAESSPFLTQPQRLQLSLEHEPLIIENPLSNETRSA
FT                   QLSTMEPPLSAYPNFYHYNQSLKMSALLKKIHTASKNANKNPIVDFKKTNELYCIRSQL
FT                   GQGGFATVYLAESSTGSLKALKVEKPASIWEFYILKQVEKRLAGQQILASIINVDSLHC
FT                   FEDESYLVLNYASQGTMLDLINLEKERNGGPLDESLCMYFAVELMKVLEYIHNVGIIHG
FT                   DLKPDNCMVRFEENPEALSDYDASGNGGWDRKGVYLIDFGRSFDLTLFPSGTRFKANWK
FT                   TDQQDCSEMREGRPWTFEADYYGLAGIIHAMLFGKFIETRLLPNQTYALTNSFKRYWRQ
FT                   DLWAPLFDVLINSGNSTKLPITSTIREHRLAFEASLEESGGRLRSQVLSLESDLQRLRK
FT                   "
     MSIGKAPVTN FDVIEVEKEN IVPLRSGRSA AALSRSLKVR SDAGAGTKVS EIRLEFEKRI        60
     LHELDELDDP LELYLDYINW INNAYPQGGQ SKQSGMLEVL ERCLMYFKDF DTYKNDPRYL       120
     KLWLWYLELF AGSESEKQSL FVFMMRKQIG SKLSLFYEEL AAFLEKQQDL PQAKDVLARG       180
     IENNARPLGR LRRTSQRFDE RMRDMSVDVP SVPHGGSILD GELPSIVLGR ARGQIEEASL       240
     KSKPSHSASA KHEIFKDVAG TDQFDDLKKE GWDHLDGRAQ RNKENEASKQ LLAPGVNLGT       300
     LKQEGSTKIS VNRVPIFKDS IGRSGPIYKI LEIPGRKPEK IDCNFDLVYP TKNQEYCFEE       360
     LLAMSRGIYH KRPKAKRVLE IETIDISDNH SRERPSKQQK KALKEISPPP EAYRPSAQES       420
     QISNENDNLQ DFKAVERTSI LPLNDEPTLH YGTQKKSAPS SPTVTFFSKD AIEEVYSMFN       480
     QNFSEPNRHL DNDDTTSKFA AFENFTQEFT RKTIDDLTEV KQKIQSEQVN ETPQKNENVP       540
     HGIEAPTEVS KETTTPSYKS KLQEYMTPIQ ERSESSFKLA SNSNEEYDNE VTKNNTITNT       600
     AESSPFLTQP QRLQLSLEHE PLIIENPLSN ETRSAQLSTM EPPLSAYPNF YHYNQSLKMS       660
     ALLKKIHTAS KNANKNPIVD FKKTNELYCI RSQLGQGGFA TVYLAESSTG SLKALKVEKP       720
     ASIWEFYILK QVEKRLAGQQ ILASIINVDS LHCFEDESYL VLNYASQGTM LDLINLEKER       780
     NGGPLDESLC MYFAVELMKV LEYIHNVGII HGDLKPDNCM VRFEENPEAL SDYDASGNGG       840
     WDRKGVYLID FGRSFDLTLF PSGTRFKANW KTDQQDCSEM REGRPWTFEA DYYGLAGIIH       900
     AMLFGKFIET RLLPNQTYAL TNSFKRYWRQ DLWAPLFDVL INSGNSTKLP ITSTIREHRL       960
     AFEASLEESG GRLRSQVLSL ESDLQRLRK                                         989
//

If you have problems or comments...

PBIL Back to PBIL home page