(data stored in SCRATCH zone)

EMBL: CU928166.PE82

CU928166.PE82        Location/Qualifiers
FT   CDS             complement(174660..176267)
FT                   /locus_tag="KLTH0B02200g"
FT                   /old_locus_tag="KLTH-ORF15703"
FT                   /product="KLTH0B02200p"
FT                   /note="highly similar to uniprot|P39077 Saccharomyces
FT                   cerevisiae YJL014W CCT3 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02200g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21447"
FT                   /db_xref="GOA:C5DCD6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD6"
FT                   /protein_id="CAR21447.1"
FT                   /translation="MQAPVVFMNTSQERTTGREAQISNITAAKAVADVIRTCLGPKAML
FT                   KMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEIL
FT                   AQCAPYIIEKNIHPVIIIQALKRALSDALEVVKQVSRPVDVENTEAMNKLIQAAIGTKY
FT                   VNHWSEKMCDLALSAVRTVRVDQGAVDDDTNRYEIDIKRYVRVEKIPGGDVLDSRVLEG
FT                   VMLNKDVVHPKMSRYIENPRVVLLDCPLEYKKGESQTNIEITREEDWNRILQIEEEQVQ
FT                   YMCEQILSVKPDLVITEKGVSDLAQHFLLKGGCSVLRRTKKSDNNRIARVTGATIVNRV
FT                   EDLKESDVGTRCGVFKVELIGDEYFTFLDKCKDPQACTVMLRGASKDILNEIERNLQDA
FT                   MAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQ
FT                   NAGGNPIRILSQLRSKHAQGNYTAGIDGDAGKVTDMVEYGVWEPEVIKQQSIKTAIESA
FT                   CLLLRVDDIVSGVRKQEE"
     MQAPVVFMNT SQERTTGREA QISNITAAKA VADVIRTCLG PKAMLKMLLD PMGGLVLTND        60
     GHAILREIDV AHPAAKSMLE LSRTQDEEVG DGTTTVIILA GEILAQCAPY IIEKNIHPVI       120
     IIQALKRALS DALEVVKQVS RPVDVENTEA MNKLIQAAIG TKYVNHWSEK MCDLALSAVR       180
     TVRVDQGAVD DDTNRYEIDI KRYVRVEKIP GGDVLDSRVL EGVMLNKDVV HPKMSRYIEN       240
     PRVVLLDCPL EYKKGESQTN IEITREEDWN RILQIEEEQV QYMCEQILSV KPDLVITEKG       300
     VSDLAQHFLL KGGCSVLRRT KKSDNNRIAR VTGATIVNRV EDLKESDVGT RCGVFKVELI       360
     GDEYFTFLDK CKDPQACTVM LRGASKDILN EIERNLQDAM AVARNVMLSP SLSPGGGATE       420
     MAVSVKLAEK AKQLEGIQQW PYQAVADAME CIPRTLIQNA GGNPIRILSQ LRSKHAQGNY       480
     TAGIDGDAGK VTDMVEYGVW EPEVIKQQSI KTAIESACLL LRVDDIVSGV RKQEE            535
//

If you have problems or comments...

PBIL Back to PBIL home page