(data stored in SCRATCH zone)

EMBL: CU928166.PE84

CU928166.PE84        Location/Qualifiers
FT   CDS             complement(178507..180393)
FT                   /locus_tag="KLTH0B02244g"
FT                   /old_locus_tag="KLTH-ORF15699"
FT                   /product="KLTH0B02244p"
FT                   /note="weakly similar to uniprot|P47069 Saccharomyces
FT                   cerevisiae YJL019W MPS3 Essential integral membrane protein
FT                   required for spindle pole body duplication and for nuclear
FT                   fusion localizes to the spindle pole body half bridge
FT                   interacts with DnaJ-like chaperone Jem1p and with centrin
FT                   homolog Cdc31p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02244g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21449"
FT                   /db_xref="GOA:C5DCD8"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD8"
FT                   /protein_id="CAR21449.1"
FT                   /translation="MDTSTHSRGFYNSKTEDAYNQMLADRRSERSAQISDSDDSVSADF
FT                   SNEMLDFSNSSSHSDLGINEDYEHFKTSLLQDDWGEPLEDDDDEDYTEEADQSFIMESD
FT                   AAEALSRGPDYHIKSFSTWIRGSLVPLVASLVVVVLAIMVLAPGGSPQAPEIQNAVPGT
FT                   NAQLRTQLNSLYREFQEEKKAAKKDLDNAIKLIILQVEKHMKQLLPRDLGSVNSQLRRL
FT                   DTQVQDLSQSLSLNNVTEWQESLMHELERLLPDQIPVVLDNSTNALMVVPELHRYLAEV
FT                   IPQAVNRTLPRGLAAPFNYDAGQYVREILRDEYEYVDKSDFLRELDSALRVNKEDILRE
FT                   MEARISTLENVPQQYSNVLQRKLIHKIYNANQHQWQDDVDFATVAQGTRILNHLCSSTF
FT                   KGHQGIPPNGVSPLDLLADTPAATSTYWLCKDKRATGSCSWAMHFAQPLYLTRISYLHG
FT                   RFTNNLHLMNSAPKSIAVYVKLQSPPTAEFQRIAAKHGQGAVWDRDNSFVEIGSWDYDV
FT                   SDARIRQYFLLPPWFVQCKPQVRSLALVVRSNHGNTHYTALRKFVINAVTAQDLQLSST
FT                   YAQQRQFEIPEYASPFEDRERSRASQIAAWQRRGPSDADPAVPSFGQDEYDR"
     MDTSTHSRGF YNSKTEDAYN QMLADRRSER SAQISDSDDS VSADFSNEML DFSNSSSHSD        60
     LGINEDYEHF KTSLLQDDWG EPLEDDDDED YTEEADQSFI MESDAAEALS RGPDYHIKSF       120
     STWIRGSLVP LVASLVVVVL AIMVLAPGGS PQAPEIQNAV PGTNAQLRTQ LNSLYREFQE       180
     EKKAAKKDLD NAIKLIILQV EKHMKQLLPR DLGSVNSQLR RLDTQVQDLS QSLSLNNVTE       240
     WQESLMHELE RLLPDQIPVV LDNSTNALMV VPELHRYLAE VIPQAVNRTL PRGLAAPFNY       300
     DAGQYVREIL RDEYEYVDKS DFLRELDSAL RVNKEDILRE MEARISTLEN VPQQYSNVLQ       360
     RKLIHKIYNA NQHQWQDDVD FATVAQGTRI LNHLCSSTFK GHQGIPPNGV SPLDLLADTP       420
     AATSTYWLCK DKRATGSCSW AMHFAQPLYL TRISYLHGRF TNNLHLMNSA PKSIAVYVKL       480
     QSPPTAEFQR IAAKHGQGAV WDRDNSFVEI GSWDYDVSDA RIRQYFLLPP WFVQCKPQVR       540
     SLALVVRSNH GNTHYTALRK FVINAVTAQD LQLSSTYAQQ RQFEIPEYAS PFEDRERSRA       600
     SQIAAWQRRG PSDADPAVPS FGQDEYDR                                          628
//

If you have problems or comments...

PBIL Back to PBIL home page