(data stored in ACNUC8465 zone)

EMBL: CU928166.PE85

CU928166.PE85        Location/Qualifiers
FT   CDS             join(180934..181515,181757..182203)
FT                   /locus_tag="KLTH0B02266g"
FT                   /old_locus_tag="Klth0B.mRNA.120.p"
FT                   /product="KLTH0B02266p"
FT                   /note="similar to uniprot|P53292 Saccharomyces cerevisiae
FT                   YGR165W MRPS35 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02266g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21450"
FT                   /db_xref="InterPro:IPR021036"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCD9"
FT                   /protein_id="CAR21450.1"
FT                   /translation="MLSPARSGPALQQVQLQQVRFISRRRTAYPFYAFKRLGKQHPKKH
FT                   DSNLKYAMRQFLGPKNFKGEYVYNKYYGVPQNHEPNYIMPEIERGQSLKDNVTGEQLAI
FT                   QTDGSIAPARVGAGRPRDPVSGKRKLQPFPSNRHCLTNRVLGEELKLQVHDDIQNKHLS
FT                   AQEVSQKYGLKIPRVEAAVKLVELEQKWEKYNRIAPSLKSMSSVLYKMFPLFVPRVEVS
FT                   RENLSEIPVPAKALRSRFMTIAESEPFGPIDAAKALELEPAAETLEKLATLGEHSAHHA
FT                   SRSSAHKEKVIYGELLKGEKSLFKFENKHVGKVGFRYGSGNRDSKKDRKIGFNELGKMV
FT                   YL"
     MLSPARSGPA LQQVQLQQVR FISRRRTAYP FYAFKRLGKQ HPKKHDSNLK YAMRQFLGPK        60
     NFKGEYVYNK YYGVPQNHEP NYIMPEIERG QSLKDNVTGE QLAIQTDGSI APARVGAGRP       120
     RDPVSGKRKL QPFPSNRHCL TNRVLGEELK LQVHDDIQNK HLSAQEVSQK YGLKIPRVEA       180
     AVKLVELEQK WEKYNRIAPS LKSMSSVLYK MFPLFVPRVE VSRENLSEIP VPAKALRSRF       240
     MTIAESEPFG PIDAAKALEL EPAAETLEKL ATLGEHSAHH ASRSSAHKEK VIYGELLKGE       300
     KSLFKFENKH VGKVGFRYGS GNRDSKKDRK IGFNELGKMV YL                          342
//

If you have problems or comments...

PBIL Back to PBIL home page