(data stored in SCRATCH zone)

EMBL: CU928166.PE86

CU928166.PE86        Location/Qualifiers
FT   CDS             182351..183724
FT                   /locus_tag="KLTH0B02288g"
FT                   /old_locus_tag="KLTH-ORF15690"
FT                   /product="KLTH0B02288p"
FT                   /note="similar to uniprot|P32893 Saccharomyces cerevisiae
FT                   YGR166W KRE11 Protein involved in biosynthesis of cell wall
FT                   beta-glucans subunit of the TRAPP (transport protein
FT                   particle) complex which is involved in the late steps of
FT                   endoplasmic reticulum to Golgi transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02288g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21451"
FT                   /db_xref="GOA:C5DCE0"
FT                   /db_xref="InterPro:IPR024662"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE0"
FT                   /protein_id="CAR21451.1"
FT                   /translation="MKILLPLDKHLDSGPESIENSHEDRKFIVFNEDLRVFFKGDQARI
FT                   ESISVFINEACVYSSSQPARSIKEREHDLWELHRSIVVDHIFNSNIVMNNGHKNTLRIV
FT                   VEYRSCAGRSTPQSARSSPDLPDLLPSFEPLNSGRTASASPQKMSMPKLQTAELAFPIH
FT                   SLLNARLRSVAVHTNQCIFSSLDLQSSKSCHTMMTLYDLARIRMSIKEIDYRIVRNFSS
FT                   VPVKPLCQLELPLEMGLWDSYSVNYQLPQTKNLDSHRVRVSLYYILEVGNYNFVVRTCW
FT                   ETDVNVRKQSAPTALPSQPTSIISTPMLTPSMIFASSVNSLVANKLNNVKFKFLTSRIT
FT                   CRKGFKFSLPLQIVNQSQSPLEIVVYCTNSAIQPQGQLPVEKEYQMHKRWMKITEGIVL
FT                   LSSDHKLPTIPVSETFCANLEFVAIQSGYYHSIPGLKVLDLNTQEIMNVGNGVKVLVE"
     MKILLPLDKH LDSGPESIEN SHEDRKFIVF NEDLRVFFKG DQARIESISV FINEACVYSS        60
     SQPARSIKER EHDLWELHRS IVVDHIFNSN IVMNNGHKNT LRIVVEYRSC AGRSTPQSAR       120
     SSPDLPDLLP SFEPLNSGRT ASASPQKMSM PKLQTAELAF PIHSLLNARL RSVAVHTNQC       180
     IFSSLDLQSS KSCHTMMTLY DLARIRMSIK EIDYRIVRNF SSVPVKPLCQ LELPLEMGLW       240
     DSYSVNYQLP QTKNLDSHRV RVSLYYILEV GNYNFVVRTC WETDVNVRKQ SAPTALPSQP       300
     TSIISTPMLT PSMIFASSVN SLVANKLNNV KFKFLTSRIT CRKGFKFSLP LQIVNQSQSP       360
     LEIVVYCTNS AIQPQGQLPV EKEYQMHKRW MKITEGIVLL SSDHKLPTIP VSETFCANLE       420
     FVAIQSGYYH SIPGLKVLDL NTQEIMNVGN GVKVLVE                                457
//

If you have problems or comments...

PBIL Back to PBIL home page