(data stored in SCRATCH zone)

EMBL: CU928166.PE89

CU928166.PE89        Location/Qualifiers
FT   CDS             186128..189772
FT                   /locus_tag="KLTH0B02354g"
FT                   /old_locus_tag="KLTH-ORF15685"
FT                   /product="KLTH0B02354p"
FT                   /note="weakly similar to uniprot|P47068 Saccharomyces
FT                   cerevisiae YJL020C BBC1 Protein possibly involved in
FT                   assembly of actin patches interacts with an actin assembly
FT                   factor Las17p and with the SH3 domains of Type I myosins
FT                   Myo3p and Myo5p localized predominantly to cortical actin
FT                   patches"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02354g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21454"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035552"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE3"
FT                   /protein_id="CAR21454.1"
FT                   /translation="MEEPEPPFTVIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFG
FT                   EYQDESGTYKEGIFPRSFVKLAGDEEPSKPVEDPLDRVPSPTQNPGAVASSERNSIPAQ
FT                   EEDVYSSEQEEDPKNSAEHNAASQAASVPVPVPVPVPAPITSSVKQEKANQPLQAEAGE
FT                   TKKAPVPIFPASFPNFGGVESGLDKSPVAPQASSADMPRDSEEDQPKMSLKQRIAMLQE
FT                   QQRLQQEREQELVQKKLEKKKKQERHEAAVIEASSTEALVIGEEQPEHPQEDSVPSTPE
FT                   ESAGPQLPSSTTVANDESTSVRRDTSEQEAAEGTQATIGGAEQERQLKDHETDDAESEG
FT                   GHAAAEEEDEEARRAALRERMAKLAGAGRMGMPGSFNPFGIPIAPPEATAAKTKKPEET
FT                   SKGDKEVSNLPRAVPVMPFADPNALPMFKNKALDTSEKEALSDSSEVPKESAGISDPRD
FT                   EENDQGSGHVVEEVISKNGASKSAHEYAKLAAPPPPLDTPGMEADAEEEAGMVENNYFG
FT                   KDARHTTVQPTQSETATPVKSQTPTQSPPIEMNRSNSKSDLASDSDGYLSSVEDISETG
FT                   PKFPKDIPHLSKHAVKNAFSSTRSLSSGIESTGDGTEANLGQNKEGGFDVVKAAQDTRL
FT                   DTATLNEYVPPHSNYLTNQHGEANIRAPPVPSAPPVPLRPSVDRVLPTDGDGERPSEAF
FT                   GASTSREAPPVPTGGSAPPIPVEKRAPPVPPVGGVPPIPLEKSTPQIPSSRGAPQVPTD
FT                   KGVPPIPTNKGAPPVPTGKQPLPIPSEPISRSTQHSATDRGHPDVPPVPSVPHAVNPIP
FT                   SENLTESNSKIGSISSEADTPNQFASSTQKTPKEAPPPPPPIATKNENILEEGPKSPPP
FT                   PPPPSVSQPSRRHNSVSSVGREKRNSGIPEVPRNIPPIPVATASHAPPSSAPSPSKSIP
FT                   ESFKNTEHSVPSSQAPSGPAGKEMKRSQTFEANLENQRPCIKFDAAEEWWLTKSIPAGL
FT                   IGNNRLKYLWEMDENRIEKRGKEQWVMRDFYFLFEDYSQLHVTVTFNEANPQLSVKFWE
FT                   EFIPRPSAGHDLEKFASKIGYKIFEQANQLINTSSRNFVPKLIEGSREPAIPPIASRTF
FT                   GVPLLTYSPESTLDEDALKLIRPGDILAVRRGKFQSHGKLLQKTTHEIGMDAVPFAGVI
FT                   TEYDFSKHKFRVIEEHNGKIKQSSYRVHDMKSGKLKVYRVVGRSYVGW"
     MEEPEPPFTV IAQFPYTSEH DDDLNFEKGS LITVQSIEDD EWYFGEYQDE SGTYKEGIFP        60
     RSFVKLAGDE EPSKPVEDPL DRVPSPTQNP GAVASSERNS IPAQEEDVYS SEQEEDPKNS       120
     AEHNAASQAA SVPVPVPVPV PAPITSSVKQ EKANQPLQAE AGETKKAPVP IFPASFPNFG       180
     GVESGLDKSP VAPQASSADM PRDSEEDQPK MSLKQRIAML QEQQRLQQER EQELVQKKLE       240
     KKKKQERHEA AVIEASSTEA LVIGEEQPEH PQEDSVPSTP EESAGPQLPS STTVANDEST       300
     SVRRDTSEQE AAEGTQATIG GAEQERQLKD HETDDAESEG GHAAAEEEDE EARRAALRER       360
     MAKLAGAGRM GMPGSFNPFG IPIAPPEATA AKTKKPEETS KGDKEVSNLP RAVPVMPFAD       420
     PNALPMFKNK ALDTSEKEAL SDSSEVPKES AGISDPRDEE NDQGSGHVVE EVISKNGASK       480
     SAHEYAKLAA PPPPLDTPGM EADAEEEAGM VENNYFGKDA RHTTVQPTQS ETATPVKSQT       540
     PTQSPPIEMN RSNSKSDLAS DSDGYLSSVE DISETGPKFP KDIPHLSKHA VKNAFSSTRS       600
     LSSGIESTGD GTEANLGQNK EGGFDVVKAA QDTRLDTATL NEYVPPHSNY LTNQHGEANI       660
     RAPPVPSAPP VPLRPSVDRV LPTDGDGERP SEAFGASTSR EAPPVPTGGS APPIPVEKRA       720
     PPVPPVGGVP PIPLEKSTPQ IPSSRGAPQV PTDKGVPPIP TNKGAPPVPT GKQPLPIPSE       780
     PISRSTQHSA TDRGHPDVPP VPSVPHAVNP IPSENLTESN SKIGSISSEA DTPNQFASST       840
     QKTPKEAPPP PPPIATKNEN ILEEGPKSPP PPPPPSVSQP SRRHNSVSSV GREKRNSGIP       900
     EVPRNIPPIP VATASHAPPS SAPSPSKSIP ESFKNTEHSV PSSQAPSGPA GKEMKRSQTF       960
     EANLENQRPC IKFDAAEEWW LTKSIPAGLI GNNRLKYLWE MDENRIEKRG KEQWVMRDFY      1020
     FLFEDYSQLH VTVTFNEANP QLSVKFWEEF IPRPSAGHDL EKFASKIGYK IFEQANQLIN      1080
     TSSRNFVPKL IEGSREPAIP PIASRTFGVP LLTYSPESTL DEDALKLIRP GDILAVRRGK      1140
     FQSHGKLLQK TTHEIGMDAV PFAGVITEYD FSKHKFRVIE EHNGKIKQSS YRVHDMKSGK      1200
     LKVYRVVGRS YVGW                                                        1214
//

If you have problems or comments...

PBIL Back to PBIL home page