(data stored in ACNUC8465 zone)

EMBL: CU928166.PE91

CU928166.PE91        Location/Qualifiers
FT   CDS             191249..192256
FT                   /locus_tag="KLTH0B02398g"
FT                   /old_locus_tag="KLTH-ORF15675"
FT                   /product="KLTH0B02398p"
FT                   /note="weakly similar to uniprot|P47065 Saccharomyces
FT                   cerevisiae YJL023C PET130 Protein required for respiratory
FT                   growth"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02398g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21456"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE5"
FT                   /protein_id="CAR21456.1"
FT                   /translation="MTSRLVLKELKAGFKATNKFPVTEKTSPVSKATAPKLMGDVMTLG
FT                   SISATNNFCKPNKRLEKPPRGERALVEVRSMLRGTNSVAQVYQNTFRIFSGQSKVYHCD
FT                   FFRLLYFPPEHFLSVFRKSKPAVNVRIVGEVFLNGNVSKSQGRSVANTAVYARGSRIEG
FT                   YGKSQDVSNLKQLQNVFANDGSNVPRNYAYLRRSLRASLNKWFIQHWMALQGPQAVEEQ
FT                   IRRQGEAGSSAQWQYLDAQGRSKTSVAKDGFYLFQVLVFPDKTTKQEFKANVARGVKTV
FT                   ADLEWDDFLRSKSNKSRTWVQECNDRVRVPVMNSYLANDQMPRVLRKLQSSRAK"
     MTSRLVLKEL KAGFKATNKF PVTEKTSPVS KATAPKLMGD VMTLGSISAT NNFCKPNKRL        60
     EKPPRGERAL VEVRSMLRGT NSVAQVYQNT FRIFSGQSKV YHCDFFRLLY FPPEHFLSVF       120
     RKSKPAVNVR IVGEVFLNGN VSKSQGRSVA NTAVYARGSR IEGYGKSQDV SNLKQLQNVF       180
     ANDGSNVPRN YAYLRRSLRA SLNKWFIQHW MALQGPQAVE EQIRRQGEAG SSAQWQYLDA       240
     QGRSKTSVAK DGFYLFQVLV FPDKTTKQEF KANVARGVKT VADLEWDDFL RSKSNKSRTW       300
     VQECNDRVRV PVMNSYLAND QMPRVLRKLQ SSRAK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page