(data stored in ACNUC8465 zone)

EMBL: CU928166.PE94

CU928166.PE94        Location/Qualifiers
FT   CDS             join(196583..196677,196756..198121)
FT                   /locus_tag="KLTH0B02464g"
FT                   /old_locus_tag="KLTH.mRNA.163AT.p"
FT                   /product="KLTH0B02464p"
FT                   /note="similar to uniprot|P46957 Saccharomyces cerevisiae
FT                   YJR006W HYS2 DNA polymerase III (delta) 55 kDa subunit
FT                   essential for cell viability involved in DNA replication
FT                   and DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02464g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21459"
FT                   /db_xref="GOA:C5DCE8"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR040663"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE8"
FT                   /protein_id="CAR21459.1"
FT                   /translation="MFKMLIKFRMSVMPTFIYGTVKSMDSVLRQFNESRETGEIEPRKR
FT                   DKLVVEPQPNEFYLKYEDRKYDEQYYSMYQYRLKVLRERVTKNCEVKWDSHFKLKNRKV
FT                   VKKNKVLDIQANEPCWCVGTIYCEMKYKPNILEEVVNDVYGAPDLVKGYLDEDGTDEVM
FT                   LEDESGRVLLVGELAKTKPLVSGTVVGILGMEADAGTFQVLDICFPSALPQTELPAGSQ
FT                   PGKVALVSGLNANPSNPRLSLKLQLLQQYLTGDVMSPESVAEIGRLIICGNSINPVDPD
FT                   QLTGCLTEAGTFFGNTLQSMPIDLMPGPRDLSDQSLPQQPLHKALFGPMISPFFEESNK
FT                   ELFCPTTNPAWFQLNGVQLLGTSGQNIDDMCKYVLPFEPDSQENLAEANIATRMDIIEG
FT                   CLRWQNIAPTAPDTLWCYPYKDEDPFVLKKWPHVFFVGNQPQFASKDVQLEGGVKVKAI
FT                   AVPEFSKTGQVVILDLETLDTTLVTIDM"
     MFKMLIKFRM SVMPTFIYGT VKSMDSVLRQ FNESRETGEI EPRKRDKLVV EPQPNEFYLK        60
     YEDRKYDEQY YSMYQYRLKV LRERVTKNCE VKWDSHFKLK NRKVVKKNKV LDIQANEPCW       120
     CVGTIYCEMK YKPNILEEVV NDVYGAPDLV KGYLDEDGTD EVMLEDESGR VLLVGELAKT       180
     KPLVSGTVVG ILGMEADAGT FQVLDICFPS ALPQTELPAG SQPGKVALVS GLNANPSNPR       240
     LSLKLQLLQQ YLTGDVMSPE SVAEIGRLII CGNSINPVDP DQLTGCLTEA GTFFGNTLQS       300
     MPIDLMPGPR DLSDQSLPQQ PLHKALFGPM ISPFFEESNK ELFCPTTNPA WFQLNGVQLL       360
     GTSGQNIDDM CKYVLPFEPD SQENLAEANI ATRMDIIEGC LRWQNIAPTA PDTLWCYPYK       420
     DEDPFVLKKW PHVFFVGNQP QFASKDVQLE GGVKVKAIAV PEFSKTGQVV ILDLETLDTT       480
     LVTIDM                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page