(data stored in ACNUC8465 zone)

EMBL: CU928166.PE95

CU928166.PE95        Location/Qualifiers
FT   CDS             complement(198167..200032)
FT                   /locus_tag="KLTH0B02486g"
FT                   /old_locus_tag="KLTH-ORF15664"
FT                   /product="KLTH0B02486p"
FT                   /note="similar to uniprot|P22438 Saccharomyces cerevisiae
FT                   YGR171C MSM1 Mitochondrial methionyl-tRNA synthetase
FT                   (MetRS), functions as a monomer in mitochondrial protein
FT                   synthesis; functions similarly to cytoplasmic MetRS
FT                   although the cytoplasmic form contains a zinc-binding
FT                   domain not found in Msm1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02486g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21460"
FT                   /db_xref="GOA:C5DCE9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCE9"
FT                   /protein_id="CAR21460.1"
FT                   /translation="MWGTSIRIVVAHSTPKGLRFWCISLFRKIINASHFKSRKPVRRTS
FT                   TMPPSRGVPARLKGALFHITTPIFYPNARPHLGHLYSSLLCDVTKRWRAMQGYNTLFTT
FT                   GTDEHGLKIQNASEKNGYSNPKQFVDVLYREFVKLDQMANISYTRFIRTTDYDHVRAVR
FT                   ELWNRCWESGYIYKGEHEGWYSISDECFYPESKVVQLQGDGQELPFGSPEIRKDGKFIN
FT                   TETRNGVVYHSETNYFFKLSSFQNRLLTFLEKENPHFISPPSRRDQIINELRGSKLRDL
FT                   SISRPSSRIKWGIDVPQDPSQKIYVWFDALCNYLTSVGGLQAVLDNSPAAVKHTITSQL
FT                   KMPRNWWVNTTHIIGKDIAKFHAIYWPCFLMAAGIPLPKQIIVHGHWLSGGVKMSKSVG
FT                   NVVDPLDMILHYECDPVRWYLLENSHIEADGDFREERLHATREQIVSKWGNLLNRCCSN
FT                   KFNIPRAVETFASQAANPENNAATLIGTEAQESYRELIQLLQTLPELFSSHMRQLETRS
FT                   ALKLLWDVIGKANAFVQTSTPWLKSGEEQDLIIFTAIEVVRITSILAQPIMPTLSNALL
FT                   DRIGVDTENRDLSRTRLGADTLYGKGSNDKGREVPIKKVNFRGTT"
     MWGTSIRIVV AHSTPKGLRF WCISLFRKII NASHFKSRKP VRRTSTMPPS RGVPARLKGA        60
     LFHITTPIFY PNARPHLGHL YSSLLCDVTK RWRAMQGYNT LFTTGTDEHG LKIQNASEKN       120
     GYSNPKQFVD VLYREFVKLD QMANISYTRF IRTTDYDHVR AVRELWNRCW ESGYIYKGEH       180
     EGWYSISDEC FYPESKVVQL QGDGQELPFG SPEIRKDGKF INTETRNGVV YHSETNYFFK       240
     LSSFQNRLLT FLEKENPHFI SPPSRRDQII NELRGSKLRD LSISRPSSRI KWGIDVPQDP       300
     SQKIYVWFDA LCNYLTSVGG LQAVLDNSPA AVKHTITSQL KMPRNWWVNT THIIGKDIAK       360
     FHAIYWPCFL MAAGIPLPKQ IIVHGHWLSG GVKMSKSVGN VVDPLDMILH YECDPVRWYL       420
     LENSHIEADG DFREERLHAT REQIVSKWGN LLNRCCSNKF NIPRAVETFA SQAANPENNA       480
     ATLIGTEAQE SYRELIQLLQ TLPELFSSHM RQLETRSALK LLWDVIGKAN AFVQTSTPWL       540
     KSGEEQDLII FTAIEVVRIT SILAQPIMPT LSNALLDRIG VDTENRDLSR TRLGADTLYG       600
     KGSNDKGREV PIKKVNFRGT T                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page