(data stored in SCRATCH zone)

EMBL: CU928166.PE96

CU928166.PE96        Location/Qualifiers
FT   CDS             complement(200122..200841)
FT                   /locus_tag="KLTH0B02508g"
FT                   /old_locus_tag="KLTH-ORF15663"
FT                   /product="KLTH0B02508p"
FT                   /note="similar to uniprot|P53039 Saccharomyces cerevisiae
FT                   YGR172C YIP1 Golgi integral membrane protein binds to the
FT                   transport GTPases Ypt1p and Ypt31p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02508g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21461"
FT                   /db_xref="GOA:C5DCF0"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF0"
FT                   /protein_id="CAR21461.1"
FT                   /translation="MSFNNGANPQGGFGFYQPSPQFQMPQGSMNFAQQPATQAFSQDPL
FT                   PPGLLNALSTKGYPHELPLLEEIGINFSHILTKTKNVLQPLRRSDSLPLEIISDCDLAG
FT                   PLIFCLLFGTLLLAAGKVHFGYIYGVALFGTISLHTLLRLMGNEDNKAQPQQLFLRTAS
FT                   ILGYCFLPLCLLSLVGVFFPLNNMMGYALALIFVCWCTWSSSGFFTAVLQLKNARVLIA
FT                   YPLSIFYSVFALMAIFV"
     MSFNNGANPQ GGFGFYQPSP QFQMPQGSMN FAQQPATQAF SQDPLPPGLL NALSTKGYPH        60
     ELPLLEEIGI NFSHILTKTK NVLQPLRRSD SLPLEIISDC DLAGPLIFCL LFGTLLLAAG       120
     KVHFGYIYGV ALFGTISLHT LLRLMGNEDN KAQPQQLFLR TASILGYCFL PLCLLSLVGV       180
     FFPLNNMMGY ALALIFVCWC TWSSSGFFTA VLQLKNARVL IAYPLSIFYS VFALMAIFV        239
//

If you have problems or comments...

PBIL Back to PBIL home page