(data stored in SCRATCH zone)

EMBL: CU928166.PE98

CU928166.PE98        Location/Qualifiers
FT   CDS             complement(202770..203798)
FT                   /locus_tag="KLTH0B02574g"
FT                   /old_locus_tag="KLTH-ORF15658"
FT                   /product="KLTH0B02574p"
FT                   /note="highly similar to uniprot|P43534 Saccharomyces
FT                   cerevisiae YFL058W THI5 Protein involved in synthesis of
FT                   the thiamine precursor hydroxymethylpyrimidine (HMP) member
FT                   of a subtelomeric gene family including THI5 THI11 THI12
FT                   and THI13"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02574g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21463"
FT                   /db_xref="GOA:C5DCF2"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF2"
FT                   /protein_id="CAR21463.1"
FT                   /translation="MSTEKITFLLNWQPAPYHIPIFLALQKGYFKEQGLDLALIEPTNP
FT                   SDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVGSLLDEPFTGLLYMAGRGITDDFQ
FT                   SLRGKKIGYVGEFGKIQLDELTKHYGMTPDDYTAVRCGMNVAKYIIEGKIDAGIGIECM
FT                   QQVELEEYLKAQGKPATDAKMLRIDKLACLGCCCFCTILYICNDKFLAANPEKVRKFLT
FT                   AVKKATDFVLAHPIDAWKEYVDFKPELDNDLSFKQFQRCYAYFSSSLFNVHRDWNKVTG
FT                   YGKRLEILPLDYKANYTNEYLSWDEPNEVEDPLEAQRLMAIHQETCRDCGGFKRLSVPL
FT                   KA"
     MSTEKITFLL NWQPAPYHIP IFLALQKGYF KEQGLDLALI EPTNPSDVTE LIGSGKVDMG        60
     LKAMIHTLAA KARGFPVTSV GSLLDEPFTG LLYMAGRGIT DDFQSLRGKK IGYVGEFGKI       120
     QLDELTKHYG MTPDDYTAVR CGMNVAKYII EGKIDAGIGI ECMQQVELEE YLKAQGKPAT       180
     DAKMLRIDKL ACLGCCCFCT ILYICNDKFL AANPEKVRKF LTAVKKATDF VLAHPIDAWK       240
     EYVDFKPELD NDLSFKQFQR CYAYFSSSLF NVHRDWNKVT GYGKRLEILP LDYKANYTNE       300
     YLSWDEPNEV EDPLEAQRLM AIHQETCRDC GGFKRLSVPL KA                          342
//

If you have problems or comments...

PBIL Back to PBIL home page