(data stored in SCRATCH zone)

EMBL: CU928166.PE99

CU928166.PE99        Location/Qualifiers
FT   CDS             204289..204732
FT                   /locus_tag="KLTH0B02596g"
FT                   /old_locus_tag="KLTH-ORF15654"
FT                   /product="KLTH0B02596p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02596g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21464"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCF3"
FT                   /protein_id="CAR21464.1"
FT                   /translation="MSILVVDMDEVRSLAQRHSIEMGLERLRVVGQYVGSWWDAGRLRL
FT                   EFGNVSGLASAGGRAVLDASESALERVRRARAGLVEGAVCDVRCCVMGRDVEVMELRVL
FT                   TLREVQALGEFLAGDAGREFMSLSSGALQHAGHDRRDDEDRAR"
     MSILVVDMDE VRSLAQRHSI EMGLERLRVV GQYVGSWWDA GRLRLEFGNV SGLASAGGRA        60
     VLDASESALE RVRRARAGLV EGAVCDVRCC VMGRDVEVME LRVLTLREVQ ALGEFLAGDA       120
     GREFMSLSSG ALQHAGHDRR DDEDRAR                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page