(data stored in ACNUC7421 zone)

EMBL: D38161.MTLA

D38161.MTLA          Location/Qualifiers
FT   CDS             249..2081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /product="mannitol-specific phophotransferase enzyme II"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /protein_id="BAA07350.1"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFGIRINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFLEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGIFLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPGPDSRSHC
FT                   RRSKRTLNITIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEKRLSCLLKARTKLSFRVIRD
FT                   GIKCHGGIHLKKQSEKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHIS
FT                   VDNFLNSPKYDELIEKLKSNLIEREYCHASTRKGNIKLNQTVSSKEEAIKLAGQTLIDN
FT                   GYVTEDYISKMFDREETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGN
FT                   TAKVVFGIAGKNNEHLDILSNIAIICSEEETLNA"
     MQQQEQQQGG MKVKVQRFGS YLSGMIMPNI GAFIAWGIIT ALFIPAGWFP NEQLNTLVSP        60
     MITYLLPLLI AYTGGKMIYD HRGGVVGATA AIGVIVGSDI PMFLGAMIMG PLGGYLIKQT       120
     DKLFKDKVKQ GFGIRINNFT AGIVGAALTI LAFYAIGPVV LTLNKLLAAG VEVIVHANLL       180
     PVASVFLEPA KVLFLNNAIN HGILSPIGIE QASQTGKSIL FLVEANPGPG LGIFLAYMFF       240
     GKGSSKSTAP GAAIIHFFGG IHEIYFPYIL MKPGPDSRSH CRRSKRTLNI TIFNAGLVAA       300
     ASPGSIIALM AMTPRGGYFG VLAGVLVAAA VSFIVSAVIL KSSKASEEDL AAATEKMQSM       360
     KGKKSQAAAA LEAEQAKAEK RLSCLLKART KLSFRVIRDG IKCHGGIHLK KQSEKAELDI       420
     SVTNTAINNL PSDADIVITH KDLTDRAKAK LPNATHISVD NFLNSPKYDE LIEKLKSNLI       480
     EREYCHASTR KGNIKLNQTV SSKEEAIKLA GQTLIDNGYV TEDYISKMFD REETSSTFMG       540
     NFIAIPHGTE EAKSEVLHSG ISIIQIPEGV EYGEGNTAKV VFGIAGKNNE HLDILSNIAI       600
     ICSEEETLNA                                                              610
//

If you have problems or comments...

PBIL Back to PBIL home page