(data stored in ACNUC7421 zone)

EMBL: D38161.PE10

D38161.PE10          Location/Qualifiers
FT   CDS             8978..9517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /protein_id="BAA07359.1"
FT                   /translation="MTKSSVVGILITSVMRIALFFAVLGVVSKGLHIDESNPAASVFKL
FT                   AAGNVGYKIFGLIMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIGFIVVSTLAF
FT                   VTIGQPAKILVLVGSLNGLILPIALGTLLVAAYKKNIVGDYKHPLWLTSTGALVVIVMA
FT                   VMGIYTLCTQLPQLWS"
     MTKSSVVGIL ITSVMRIALF FAVLGVVSKG LHIDESNPAA SVFKLAAGNV GYKIFGLIMW        60
     SAAITSVIGA AYTSVSFFKT FSPKIEKNSR GIIIGFIVVS TLAFVTIGQP AKILVLVGSL       120
     NGLILPIALG TLLVAAYKKN IVGDYKHPLW LTSTGALVVI VMAVMGIYTL CTQLPQLWS        179
//

If you have problems or comments...

PBIL Back to PBIL home page