(data stored in ACNUC7421 zone)

EMBL: D38161.PE11

D38161.PE11          Location/Qualifiers
FT   CDS             9541..10314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="unknown protein"
FT                   /db_xref="GOA:P42966"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42966"
FT                   /protein_id="BAA07360.1"
FT                   /translation="MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLF
FT                   CQRNQKPCPVLDVTEAGSPVPSLLRRMLISRTDFPKYRIYRHGILTEEVSDITPYWEDD
FT                   FVGFLIGCSFSFEQALINNGIAVRHIDEGTNVSMYKTNIDCFPVGAFHGQMVVSMRPVP
FT                   ERLAVRAAQVTSRFPAVHGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGV
FT                   TPQAVAMNVKPEMVITHAPGHMLITDIRDESLAVL"
     MAPKDVRALI REGKINGPTA GMSGGYAQAN LVVLKKDLAF DFLLFCQRNQ KPCPVLDVTE        60
     AGSPVPSLLR RMLISRTDFP KYRIYRHGIL TEEVSDITPY WEDDFVGFLI GCSFSFEQAL       120
     INNGIAVRHI DEGTNVSMYK TNIDCFPVGA FHGQMVVSMR PVPERLAVRA AQVTSRFPAV       180
     HGGPIHIGNP GAIGIRDLGK PDFGDAVSIR DGEVPVFWAC GVTPQAVAMN VKPEMVITHA       240
     PGHMLITDIR DESLAVL                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page